BioLiP

>protein
LCSLDNGDCDQFCVVCSCARGYTLAKACIPTGPYPCGKQTLE

The query sequence (length=42) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2vwn:L	44	44	1.0000	0.9545	0.9545	6.24e-24	2vwo:L
2	1p0s:L	99	51	1.0000	0.4242	0.8235	7.52e-22	2y80:B
3	1xkb:A	91	51	1.0000	0.4615	0.8235	8.90e-21	3k9x:A
4	8eph:A	91	50	0.5476	0.2527	0.4600	1.25e-07	1edm:B, 1edm:C, 8eph:C
5	4bxw:B	287	43	0.4286	0.0627	0.4186	1.21e-04	4bxw:A
6	6r2w:L	143	48	0.4524	0.1329	0.3958	8.78e-04	2a2q:L, 2aei:L, 2aer:L, 2b8o:L, 2c4f:L, 8cn9:D, 8cn9:I, 8cn9:S, 1dan:L, 1dva:L, 1dva:M, 2ec9:L, 3ela:L, 1fak:L, 1ff7:A, 1ffm:A, 2fir:L, 4ibl:L, 1j9c:L, 5l0s:B, 5par:A, 2puq:L, 1qfk:L, 3th2:L, 3th3:L, 3th4:L, 1w0y:L, 1w2k:L, 1wqv:L, 1wss:L, 1wtg:L, 1wun:L, 1wv7:L, 4ylq:L, 1z6j:L, 4z6a:L, 4zma:L, 2zp0:L, 2zwl:L, 2zzu:L
7	6l6r:A	610	38	0.2857	0.0197	0.3158	0.51	6l6r:B, 7nam:A, 3sob:B, 3soq:A, 3sov:A
8	8dvm:A	612	41	0.3095	0.0212	0.3171	0.57	4a0p:A, 8dvl:A, 8dvn:A
9	3h5c:B	312	43	0.4048	0.0545	0.3953	1.5
10	3hee:A	148	28	0.1905	0.0541	0.2857	2.2	3hee:B, 3ph3:A, 3ph3:B, 3ph4:A, 3ph4:B
11	3h0g:C	263	12	0.1905	0.0304	0.6667	2.4	3h0g:O
12	2xva:A	199	21	0.2143	0.0452	0.4286	4.8	2xva:B, 2xva:C, 2xva:D, 2xvm:A, 2xvm:B
13	8em4:A	3818	22	0.1905	0.0021	0.3636	5.5	8em4:B
14	8em7:A	4378	22	0.1905	0.0018	0.3636	7.0	8em7:B, 8jut:A, 8jut:B, 8juu:B, 8juu:A, 8jx8:B, 8jx8:A, 8jx9:B, 8jxa:A, 8jxb:A, 8jxd:A, 8jxe:A, 8jxe:B, 8jxf:B, 8jxg:A, 8jxh:A, 8jxi:B

[Back]