LCGRVFKSGETTYSCRDCAIDPTCVLCMDCFQDSVHKNHRYKMHTSTGGGFCDCGDTEAWKTGPFCVNHE
The query sequence (length=70) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3ny1:A | 73 | 70 | 1.0000 | 0.9589 | 1.0000 | 5.63e-49 | 3ny1:B, 5tdc:A, 5tdc:C |
2 | 3ny2:D | 73 | 70 | 0.7714 | 0.7397 | 0.7714 | 2.73e-29 | 3ny2:A, 3ny2:B, 3ny2:C, 3ny2:E, 3ny2:F, 3ny2:G, 3ny2:H, 3ny3:A, 5tda:A, 5tdb:A, 5tdd:A, 5um3:A |
3 | 7wul:A | 70 | 70 | 0.5000 | 0.5000 | 0.5000 | 4.86e-19 | 7wuk:A, 7wum:A, 7wun:A |
4 | 7mex:A | 1737 | 71 | 0.4714 | 0.0190 | 0.4648 | 1.70e-17 | 6kgi:B, 7mey:A, 3nih:A, 3nii:A, 3nij:A, 3nik:B, 3nik:D, 3nik:A, 3nik:F, 3nil:D, 3nil:A, 3nil:B, 3nil:F, 3nim:B, 3nim:F, 3nim:A, 3nim:D, 3nin:A, 3nin:B, 3nis:A, 3nis:B, 3nis:D, 3nis:F, 3nit:A |
5 | 7y70:A | 77 | 65 | 0.4429 | 0.4026 | 0.4769 | 4.53e-16 | 6lhn:A, 7xwd:A, 7xwe:A, 7xwe:B, 7xwf:A, 7xwg:A, 7xwg:B, 7y6w:A, 7y6x:A, 7y6x:B, 7y6x:D, 7y6x:E, 7y6x:F, 7y6x:G, 7y6x:H, 7y6x:C, 7y6y:A, 7y6y:B, 7y6y:C, 7y6y:D, 7y6z:A |
6 | 8bja:B | 1638 | 53 | 0.2000 | 0.0085 | 0.2642 | 0.006 | |
7 | 8ewi:A | 1775 | 53 | 0.2000 | 0.0079 | 0.2642 | 0.006 | 8ewi:B, 8ewi:C, 8ewi:D |
8 | 8bja:A | 1563 | 53 | 0.2000 | 0.0090 | 0.2642 | 0.007 | |
9 | 8p82:A | 1596 | 53 | 0.2000 | 0.0088 | 0.2642 | 0.007 | 8p82:B |
10 | 8d4x:B | 1669 | 53 | 0.2000 | 0.0084 | 0.2642 | 0.007 | 8c06:A, 8c06:D |
11 | 8e0q:A | 1689 | 53 | 0.2000 | 0.0083 | 0.2642 | 0.007 | 8d4x:A, 8e0q:B |
12 | 6o9w:A | 227 | 36 | 0.1429 | 0.0441 | 0.2778 | 0.96 | |
13 | 8exs:A | 556 | 36 | 0.1429 | 0.0180 | 0.2778 | 1.0 | 8c0p:A, 8c0p:B, 8c0s:A, 8c0s:B, 8cf3:C, 8cf3:E, 8exp:A, 8exp:B, 8exq:B, 8exq:A, 8exr:B, 8exr:A, 8exs:B, 8ext:A, 8ext:B, 6o9w:B, 3q7z:A, 3q7z:B, 3q81:A, 3q81:B, 3q82:A, 3q82:B, 1xa1:A, 1xa1:B, 1xa1:C, 1xa1:D, 1xa7:A, 1xa7:B, 1xkz:A, 1xkz:B, 1xkz:C, 1xkz:D |
14 | 8e9b:B | 387 | 23 | 0.1429 | 0.0258 | 0.4348 | 2.6 | 8uxw:B, 8uxx:B, 6w17:B, 6w18:B |
15 | 1wig:A | 73 | 46 | 0.2000 | 0.1918 | 0.3043 | 2.8 | |
16 | 6kqs:A | 620 | 38 | 0.1714 | 0.0194 | 0.3158 | 2.8 | 6kqt:A |
17 | 7mju:A | 184 | 20 | 0.1429 | 0.0543 | 0.5000 | 3.2 | 5dag:A, 5dah:B, 5dah:A |
18 | 6xig:B | 383 | 24 | 0.1571 | 0.0287 | 0.4583 | 3.6 | 6xi9:A, 6xi9:B, 6xig:A |
19 | 3pfq:A | 523 | 18 | 0.1286 | 0.0172 | 0.5000 | 4.0 | 1a25:A, 1a25:B, 2i0e:A, 2i0e:B |
20 | 8bob:A | 390 | 42 | 0.2000 | 0.0359 | 0.3333 | 4.2 | 8bob:B, 1d2f:A, 1d2f:B |
21 | 2bwj:B | 195 | 27 | 0.1571 | 0.0564 | 0.4074 | 4.8 |