BioLiP

>protein
KVPEAAISRLITYLRILEELEAQGVHRTSSEQLGGLAQVTAFQVRKDLSYFGSYGTRGVGYTVPVLKRELRHILGLNRKW
GLCIVGMGRLGSALADYPGFGESFELRGFFDVDPEKVGRPVRGGVIEHVDLLPQRVPGRIEIALLTVPREAAQKAADLLV
AAGIKGILNFAPVVLEVPKEVAVENVDFLAGLTRLSFAILNPKWREEMMG

The query sequence (length=210) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2dt5:B	211	210	1.0000	0.9953	1.0000	4.42e-152	2dt5:A, 3ikt:A, 3ikt:B, 3il2:A, 3il2:B, 1xcb:A, 1xcb:B, 1xcb:C, 1xcb:D, 1xcb:E, 1xcb:F, 1xcb:G
2	5zz7:A	206	203	0.4238	0.4320	0.4384	8.23e-46	7wb3:A, 7wb3:B, 5zz6:A, 5zz6:B, 5zz6:C, 5zz6:D, 5zz7:B
3	2vt3:B	208	209	0.3571	0.3606	0.3589	5.71e-38	2vt2:A, 2vt2:B, 2vt3:A
4	3wgi:A	217	198	0.3905	0.3779	0.4141	6.07e-37	3wgg:A, 3wgg:B, 3wgh:A, 3wgh:B, 3wgi:B, 3wgi:C, 3wgi:D
5	3keo:B	207	202	0.3429	0.3478	0.3564	1.62e-34	3keo:A, 3keq:A, 3keq:B, 3ket:A
6	3e18:A	348	132	0.1333	0.0805	0.2121	0.016	3e18:B
7	7xdu:B	348	34	0.0619	0.0374	0.3824	1.5	7xdu:A
8	5f9t:A	659	41	0.0667	0.0212	0.3415	1.7	5f9t:B, 4yw1:A, 4yw1:B, 4yw2:A, 4yw2:B, 4yw3:A, 4yw3:B, 4yw5:A, 4yw5:B, 4yz2:A, 4yz2:B, 4yz3:A, 4yz3:B, 4yz4:A, 4yz4:B, 4yz5:A, 4yz5:B
9	6sy0:A	137	42	0.0714	0.1095	0.3571	1.8	6sy0:B
10	1o5k:A	295	57	0.0905	0.0644	0.3333	2.0
11	6xqn:C	154	43	0.0762	0.1039	0.3721	3.2	6x4s:A, 6x4s:B, 6x4s:C, 6x4s:D, 6xqn:D
12	3wv5:A	387	29	0.0619	0.0336	0.4483	7.5	3wvn:A
13	2fdc:A	505	84	0.0952	0.0396	0.2381	7.9
14	5m45:B	709	83	0.1095	0.0324	0.2771	8.5	5m45:E, 5m45:H, 5m45:K, 5svb:B, 5svb:E

[Back]