KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISL
IERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF
The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1ngk:B | 127 | 126 | 1.0000 | 0.9921 | 1.0000 | 2.24e-91 | 1ngk:A, 1ngk:C, 1ngk:D, 1ngk:E, 1ngk:F, 1ngk:G, 1ngk:H, 1ngk:I, 1ngk:J, 1ngk:K, 1ngk:L, 2qrw:A, 2qrw:B, 2qrw:C, 2qrw:D, 2qrw:E, 2qrw:F, 2qrw:G, 2qrw:H, 2qrw:I, 2qrw:J, 2qrw:K, 2qrw:L |
2 | 4uzv:A | 129 | 124 | 0.5317 | 0.5194 | 0.5403 | 6.28e-41 | 2bmm:A |
3 | 5d1v:A | 121 | 122 | 0.4603 | 0.4793 | 0.4754 | 1.24e-32 | 5d1v:B |
4 | 2bkm:A | 128 | 125 | 0.3810 | 0.3750 | 0.3840 | 1.40e-24 | 2bkm:B |
5 | 5v3u:A | 131 | 122 | 0.3413 | 0.3282 | 0.3525 | 8.35e-23 | 5v3t:A, 5v3t:B, 5v3u:B, 5v3v:A, 5v3v:B |
6 | 1ux8:A | 118 | 120 | 0.3810 | 0.4068 | 0.4000 | 1.19e-22 | |
7 | 2xyk:B | 130 | 113 | 0.3333 | 0.3231 | 0.3717 | 6.14e-17 | 2xyk:A |
8 | 4uur:A | 124 | 127 | 0.3492 | 0.3548 | 0.3465 | 7.47e-14 | 4uur:B |
9 | 4c0n:A | 150 | 116 | 0.2698 | 0.2267 | 0.2931 | 1.07e-11 | 4c44:A |
10 | 2ksc:A | 123 | 56 | 0.1429 | 0.1463 | 0.3214 | 3.90e-05 | 4l2m:A, 4l2m:B, 4max:A, 4max:B, 4max:C |
11 | 3aq5:A | 117 | 112 | 0.2063 | 0.2222 | 0.2321 | 5.28e-05 | 3aq5:B, 3aq6:A, 3aq6:B, 3aq7:A, 3aq7:B, 3aq8:A, 3aq8:B, 3aq9:A, 3aq9:B |
12 | 4nk2:A | 164 | 49 | 0.1349 | 0.1037 | 0.3469 | 4.13e-04 | 4nk1:A, 4nk1:B, 4nk2:B |
13 | 1dlw:A | 116 | 78 | 0.1429 | 0.1552 | 0.2308 | 7.39e-04 | 1uvy:A |
14 | 2hz1:A | 123 | 59 | 0.1270 | 0.1301 | 0.2712 | 8.61e-04 | 2hz2:A, 2hz3:A, 1mwb:A, 1rtx:A, 1s69:A, 1s6a:A |
15 | 1s56:B | 135 | 60 | 0.1270 | 0.1185 | 0.2667 | 0.004 | 5ab8:A, 2gkm:A, 2gkm:B, 2gkn:A, 2gkn:B, 2gl3:A, 2gl3:B, 2gln:A, 2gln:B, 1idr:A, 1idr:B, 1rte:A, 1rte:B, 1s56:A, 1s61:A, 1s61:B |
16 | 8tls:A | 116 | 120 | 0.2222 | 0.2414 | 0.2333 | 0.39 | 8tls:B, 7tt9:A, 7tt9:B, 7tt9:C, 7tt9:D, 8ugz:A, 8ugz:B, 8ugz:C, 8ugz:D, 8uzu:A, 8uzu:B, 8uzu:C, 8uzu:D, 8vij:A, 8vij:B, 8vij:C, 8vij:D, 8vsh:A, 8vsh:B, 8vsh:C, 8vsh:D, 8w3a:A, 8w3a:B, 8w3a:C, 8w3a:D |
17 | 1dly:A | 121 | 55 | 0.1032 | 0.1074 | 0.2364 | 0.93 | 1uvx:A |
18 | 4v4n:Aj | 94 | 33 | 0.0952 | 0.1277 | 0.3636 | 2.0 | 6skf:Bl, 6skg:Bl, 6th6:Bl, 4v6u:Bj |
19 | 1zov:A | 381 | 39 | 0.1270 | 0.0420 | 0.4103 | 5.9 | 1zov:B |
20 | 4xdi:A | 127 | 59 | 0.1111 | 0.1102 | 0.2373 | 6.2 | 6cii:A, 4xdi:B |
21 | 4iqd:A | 290 | 58 | 0.1429 | 0.0621 | 0.3103 | 7.6 | 4iqd:B |
22 | 2vpq:B | 448 | 34 | 0.1270 | 0.0357 | 0.4706 | 8.0 | 2vpq:A |