BioLiP

>protein
KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK

The query sequence (length=45) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1bhp:A	45	45	1.0000	1.0000	1.0000	1.49e-26
2	2plh:A	45	45	0.8889	0.8889	0.8889	1.36e-23
3	1wuw:A	45	45	0.8667	0.8667	0.8667	9.51e-23	1wuw:B
4	1okh:A	46	46	0.5556	0.5435	0.5435	1.28e-10	1okh:B
5	2v9b:A	46	46	0.4889	0.4783	0.4783	4.59e-09	2v9b:B
6	6tg9:G	148	33	0.2444	0.0743	0.3333	1.9	6tg9:C, 6tga:G, 6tga:C
7	3jd5:c	168	52	0.3333	0.0893	0.2885	2.2	6neq:c, 6nf8:c
8	5aj3:c	169	25	0.1778	0.0473	0.3200	8.9	5aj4:Ac, 6gaw:Ac, 6gaz:Ac, 7nqh:Ac, 7nql:Ac, 7nsi:Ac, 7nsj:Ac, 8oin:AT, 8oip:AT, 6ydp:Ac, 6ydw:Ac
9	7pnt:T	170	25	0.1778	0.0471	0.3200	9.0	7a5f:T6, 7a5g:T6, 7a5i:T6, 7a5k:T6, 8any:AT, 8csp:T, 8csq:T, 8csr:T, 8css:T, 8cst:T, 8csu:T, 3j9m:AT, 8k2a:Sa, 7l08:AT, 6nu2:AT, 6nu3:AT, 7og4:AT, 8oir:AT, 8ois:AT, 7p2e:T, 7pnu:T, 7pnv:T, 7pnw:T, 7pnx:T, 7pny:T, 7pnz:T, 7po0:T, 7po1:T, 7po2:T, 7po3:T, 7qi4:AT, 7qi5:AT, 7qi6:AT, 8qrk:T, 8qrl:T, 8qrm:T, 8qrn:T, 6rw4:T, 6rw5:T, 6vlz:AT, 6vmi:AT, 8xt0:Sa, 8xt2:Sa, 6zm5:AT, 6zm6:AT, 6zs9:AT, 6zsa:AT, 6zsb:AT, 6zsc:AT, 6zsd:AT, 6zse:AT, 6zsg:AT
10	7rpk:A	953	34	0.2667	0.0126	0.3529	9.2	7rph:A, 7rpi:A, 7rpj:A

[Back]