KRTGKPADTPDYKQVYLPYDAAPTERELERERRRFKQAYHGRMEHRKLVEVKEVPLNVYTYGKEGMSLPIAIFKDQKDPV
IGPEWTYPGIYENKIAAQHWYTEELFDKESKEAFESPWQQQILDNQVKRRMAKVMFRMRQVNMKAVDLFQKERGS
The query sequence (length=155) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6hiv:BV | 155 | 155 | 1.0000 | 1.0000 | 1.0000 | 3.41e-115 | 6hix:BV |
2 | 7aih:Av | 155 | 155 | 0.7355 | 0.7355 | 0.7355 | 2.50e-89 | 7ane:Av |
3 | 8fs6:G | 298 | 51 | 0.1097 | 0.0570 | 0.3333 | 0.91 | |
4 | 3mao:A | 105 | 46 | 0.1097 | 0.1619 | 0.3696 | 4.5 | |
5 | 2v5d:A | 722 | 24 | 0.0710 | 0.0152 | 0.4583 | 6.6 | 2cbi:A, 2cbi:B, 2cbj:A, 2cbj:B, 2j1a:A, 2j1e:A, 2j62:A, 2j62:B, 2j7m:A, 7khv:A, 7khv:B, 7khv:C, 7khv:D, 7khv:E, 7khv:F, 5oxd:A, 6rhe:A, 2v5c:A, 2v5c:B, 2vur:A, 2vur:B, 2wb5:A, 2wb5:B, 2x0y:A, 2x0y:B, 2xpk:A, 2xpk:B, 2ydq:A, 2ydr:A, 2yds:A, 4zxl:A |
6 | 7uhy:C | 578 | 32 | 0.0581 | 0.0156 | 0.2812 | 9.7 |