KRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQSKENYPWELYTDFNEIVQYLSGAHGNSDPVCLFV
CNKDPDVPLVLLQQIPLLCYMAPMTVKLVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIK
YRPTSVKLLKTTVPI
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6agb:C | 175 | 175 | 1.0000 | 1.0000 | 1.0000 | 2.95e-129 | 6ah3:C |
2 | 3t3z:B | 464 | 155 | 0.2000 | 0.0754 | 0.2258 | 0.22 | 3e4e:A, 3e4e:B, 3e6i:A, 3e6i:B, 3gph:A, 3gph:B, 3koh:A, 3koh:B, 3lc4:A, 3lc4:B, 3t3z:D, 3t3z:A, 3t3z:C |
3 | 1q0d:A | 117 | 28 | 0.0800 | 0.1197 | 0.5000 | 1.1 | 1q0d:B, 1q0d:C, 1q0d:D, 1q0d:E, 1q0d:F, 1q0d:G, 1q0d:H, 1q0d:I, 1q0d:J, 1q0d:K, 1q0d:L, 1q0f:A, 1q0f:B, 1q0f:C, 1q0f:D, 1q0f:E, 1q0f:F, 1q0f:G, 1q0f:H, 1q0f:I, 1q0f:J, 1q0f:K, 1q0f:L, 1q0g:A, 1q0g:B, 1q0g:C, 1q0g:D, 1q0g:E, 1q0g:F, 1q0g:G, 1q0g:H, 1q0g:I, 1q0g:J, 1q0g:K, 1q0g:L, 1q0k:A, 1q0k:B, 1q0k:C, 1q0k:D, 1q0k:E, 1q0k:F, 1q0k:G, 1q0k:I, 1q0k:H, 1q0k:J, 1q0k:K, 1q0k:L, 1q0m:A, 1q0m:B, 1q0m:C, 1q0m:D, 1q0m:E, 1q0m:F |
4 | 4r7p:A | 485 | 20 | 0.0629 | 0.0227 | 0.5500 | 2.6 | 4r7p:B, 4r7p:C |
5 | 2y9w:A | 391 | 47 | 0.0971 | 0.0435 | 0.3617 | 4.3 | 2y9w:B, 2y9x:A, 2y9x:B, 2y9x:C, 2y9x:D |
6 | 3j79:Y | 101 | 52 | 0.0686 | 0.1188 | 0.2308 | 5.4 | 3jbn:AY, 3jbo:AY, 3jbp:AY, 8tpu:AY, 5umd:Y |
7 | 7sba:I | 899 | 78 | 0.1029 | 0.0200 | 0.2308 | 6.8 | 7sba:K, 7sbb:J, 7sbb:K |
8 | 7w7g:B | 1711 | 28 | 0.0686 | 0.0070 | 0.4286 | 8.7 | |
9 | 1doa:B | 200 | 70 | 0.1086 | 0.0950 | 0.2714 | 8.9 | 4f38:B, 5fr1:B, 5fr2:B, 1hh4:D, 1hh4:E |