KREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYC
The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1dh3:A | 55 | 53 | 0.9434 | 0.9091 | 0.9434 | 8.68e-29 | 1dh3:C, 5zk1:A, 5zko:A, 5zko:C |
2 | 5vpe:D | 67 | 44 | 0.3019 | 0.2388 | 0.3636 | 0.041 | 5vpe:B, 5vpf:B, 5vpf:D |
3 | 8k86:A | 63 | 42 | 0.3396 | 0.2857 | 0.4286 | 0.086 | 8k86:B, 8k8a:A, 8k8a:B |
4 | 1t2k:D | 61 | 50 | 0.3396 | 0.2951 | 0.3600 | 0.15 | |
5 | 2gu2:A | 307 | 40 | 0.2830 | 0.0489 | 0.3750 | 0.33 | 2gu2:B, 2q4z:B |
6 | 5t01:A | 62 | 35 | 0.2830 | 0.2419 | 0.4286 | 0.50 | 1a02:J, 1fos:F, 1fos:H, 5fv8:D, 2h7h:A, 2h7h:B, 1jnm:A, 1jnm:B, 1s9k:E, 5t01:B |
7 | 4mri:B | 303 | 40 | 0.2642 | 0.0462 | 0.3500 | 0.55 | 2i3c:A, 2i3c:B, 4mri:A, 4mxu:A, 4mxu:B, 4nfr:A, 4nfr:B, 2o4h:A, 2o4h:B, 2o53:A, 2o53:B, 2q51:A, 2q51:B, 4tnu:A, 4tnu:B |
8 | 4a0l:E | 709 | 29 | 0.1698 | 0.0127 | 0.3103 | 2.0 | 4a0l:H, 8ei1:A, 8ei1:B, 8ei1:C, 8ei1:D |
9 | 2d8q:A | 70 | 40 | 0.2642 | 0.2000 | 0.3500 | 5.0 | 2dan:A |
10 | 4a75:A | 89 | 24 | 0.1887 | 0.1124 | 0.4167 | 6.2 | 4a75:C, 4a75:E, 4a75:G, 4a76:A, 4a76:G, 4a76:C, 4a76:E, 4alp:A, 4alp:D |
11 | 6brd:A | 474 | 52 | 0.2642 | 0.0295 | 0.2692 | 7.4 | 6brd:B, 6brd:C, 5vqb:A, 5vqb:B, 5vqb:C |