KPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQE
The query sequence (length=50) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8r0a:L | 292 | 50 | 1.0000 | 0.1712 | 1.0000 | 6.69e-30 | 6ah0:L |
2 | 5o9z:H | 413 | 50 | 1.0000 | 0.1211 | 1.0000 | 3.25e-29 | 6ahd:L, 8h6e:4D, 8h6k:4D, 8h6l:4D, 2ozb:B, 2ozb:E, 8q7n:L, 8qo9:L, 8qoz:L, 8qp8:L, 8qp9:L, 8qpa:L, 8qpb:L, 8qpe:L, 8qpk:L, 6qw6:4C, 6qx9:4C, 8qxd:L, 8qzs:L, 8r08:L, 8r09:L, 8r0b:L, 8rm5:L, 3siu:B, 3siu:E, 3siv:B, 3siv:E, 3siv:H, 3siv:K, 8y6o:L |
3 | 3jcm:I | 416 | 53 | 0.5000 | 0.0601 | 0.4717 | 1.70e-08 | 5gan:F, 5gap:F, 5nrl:F, 5zwm:L, 5zwo:L |
4 | 1r6v:A | 671 | 30 | 0.2200 | 0.0164 | 0.3667 | 1.8 | |
5 | 4k0x:A | 243 | 26 | 0.1800 | 0.0370 | 0.3462 | 2.4 | 4jf4:A, 4jf4:B, 4k0w:A, 6n6u:A, 6n6v:A, 6n6x:A, 6n6y:A, 7t7d:A, 7t7e:A, 7t7f:A, 7t7g:A, 5wi3:B, 5wi3:A, 5wi7:A, 5wi7:B, 5wib:A, 5wib:B, 4x55:A, 4x55:B |
6 | 6yw5:OO | 276 | 20 | 0.2200 | 0.0399 | 0.5500 | 2.7 | 6ywe:OO, 6ywx:OO, 6ywy:OO |
7 | 8g4c:B | 248 | 41 | 0.2600 | 0.0524 | 0.3171 | 5.7 | 8g4c:C, 8g4d:B, 8g4d:C, 7tch:B, 7tch:C |
8 | 6zj3:LW | 208 | 32 | 0.2800 | 0.0673 | 0.4375 | 6.8 | |
9 | 4ztx:A | 768 | 58 | 0.3400 | 0.0221 | 0.2931 | 7.2 |