BioLiP

>protein
KPIKTLLITGQNNHNWQVSHVVLKQILENSGRFDVDFVISPEQGKDMSGFVLDFSPYQLVVLDYNGDSWPEETNRRFLEY
VQNGGGVVIYHAADNAFSKWPEFNRICALGGWEGRNENSGPYVYWKDGKLVKDSSAGPGGSHGRQHEYVLNGRDKVHPVV
KGLPLKWRHAKDELYDRMRGPGNIRDILYTAYSDKETNGSGREEPLVFTVDYGNARIFHTMLGHAGATTEDNIAMQCTGF
QVLLLRGAEWAATGKVTQKVPKDFPTETTCSYRKDYKEN

The query sequence (length=279) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4e5v:A	280	279	1.0000	0.9964	1.0000	0.0	4e5v:B
2	6q03:A	416	65	0.0753	0.0505	0.3231	0.25	6q0a:A, 6q0y:A, 6q11:A
3	4qhz:C	240	51	0.0753	0.0875	0.4118	0.29	4qhz:A, 4qhz:B, 4qhz:D
4	4pxy:A	244	152	0.1290	0.1475	0.2368	0.63	4pxy:B
5	7uac:H	546	25	0.0394	0.0201	0.4400	0.75	7uab:E, 7uab:H, 7uae:A, 7uaf:B, 7uaf:A, 7uaf:C, 7uaf:D, 7uai:E, 7uai:B, 7uai:C, 7uai:D
6	7uab:A	481	25	0.0394	0.0229	0.4400	0.85	7uab:D
7	3vyw:D	306	141	0.1111	0.1013	0.2199	1.7	3vyw:A, 3vyw:B, 3vyw:C
8	3ujj:H	230	85	0.0753	0.0913	0.2471	2.5	6vbo:H
9	2rjo:A	322	57	0.0645	0.0559	0.3158	5.0
10	6q45:A	476	65	0.0789	0.0462	0.3385	7.2	6q45:B, 6q45:C, 6q45:I, 6q45:J, 6q45:K
11	7qx0:B	443	30	0.0502	0.0316	0.4667	7.4	7qx0:A, 7qx0:C, 7qx0:D, 7qx3:B, 7qx3:C, 7qx3:A, 7qx3:D
12	6gi5:B	271	81	0.0717	0.0738	0.2469	8.3	6gi1:A, 6gi1:B, 6gi2:A, 6gi2:B, 6gi5:A

[Back]