KNSEMKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRLRERWDSLVESA
The query sequence (length=61) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 5kc1:F | 61 | 61 | 1.0000 | 1.0000 | 1.0000 | 6.91e-38 | 5kc1:D, 5kc1:B, 5kc1:L, 5kc1:J |
| 2 | 1q4s:A | 142 | 37 | 0.2459 | 0.1056 | 0.4054 | 0.14 | 1q4s:B, 1q4t:A, 1q4t:B, 1q4u:A, 1q4u:B, 3r32:A, 3r32:B, 3r34:A, 3r34:B, 3r35:A, 3r35:B, 3r37:A, 3r37:B, 3r3a:A, 3r3a:B, 3r3b:A, 3r3b:B, 3r3c:A, 3r3c:B, 3r3d:A, 3r3d:B, 3r3f:A, 3r3f:B, 3tea:A, 3tea:B |
| 3 | 6ax8:A | 509 | 41 | 0.2623 | 0.0314 | 0.3902 | 1.2 | 5xet:C |
| 4 | 6fah:E | 393 | 43 | 0.2951 | 0.0458 | 0.4186 | 1.3 | 6fah:A |
| 5 | 3fxr:A | 296 | 20 | 0.1475 | 0.0304 | 0.4500 | 1.6 | 3fxu:A, 3fxu:B, 3n6u:A |
| 6 | 8pz4:A | 466 | 31 | 0.1475 | 0.0193 | 0.2903 | 1.8 | 7acg:A, 4afk:A, 4azl:A, 4azl:B, 4b61:A, 4b61:B, 8q2o:A, 3rbh:A, 3rbh:B, 8rqp:A, 4xnk:A, 4xnl:A |
| 7 | 3rbh:D | 410 | 31 | 0.1475 | 0.0220 | 0.2903 | 1.8 | 3rbh:C |
| 8 | 8c29:R | 219 | 28 | 0.2131 | 0.0594 | 0.4643 | 2.9 | 8c29:r |
| 9 | 6fli:A | 310 | 27 | 0.2131 | 0.0419 | 0.4815 | 3.7 | 6fli:B, 6fli:C, 6fli:D, 6fli:E, 6fvs:D |
| 10 | 9ax8:z | 509 | 37 | 0.1967 | 0.0236 | 0.3243 | 5.2 | 3jcj:f, 3jcn:b, 5me0:W, 5me1:W, 6o7k:f, 6o9k:z |
| 11 | 6qv4:A | 1666 | 44 | 0.1803 | 0.0066 | 0.2500 | 6.7 | 6qv3:A |
| 12 | 6mve:A | 680 | 22 | 0.1475 | 0.0132 | 0.4091 | 8.7 | 6cgl:A, 6cgl:B, 6cgn:A, 6mt9:A, 6mv9:A, 6mv9:B, 6mw3:D, 6mw3:C, 6myx:C, 6myx:D, 6myx:I, 6myx:J |
| 13 | 7mqa:SS | 350 | 56 | 0.2459 | 0.0429 | 0.2679 | 9.6 |
umich.edu