BioLiP

>protein
KNPISPTIPLDRDGVFHGFLKLPHSRDDSAWGSVMIPLTVIKNGAGPTALLTGANHGDEYEGPVALHELAATTSAEDVTG
RLIIVPAFNYPAFRAGSRTSPIDRGNLNRSFPGRPDGTVTEKIADYFQRTLLPMADLAVDFHSGGKTLDFVPFAAAHILE
DKATQAACFAAMKAFNAPYSVELLEIDSAGMYDTAVEEMGKVLVTTELGGGGSSSARSNAIAKKGLRNVLIHAGILKGEM
QLDETVNLTMPDDDCFVFSEGDGLFEMMIDLGAPVAKGDLLARVWPLDRTGQPPVEYRARRAGLVISRHFPGLIKSGDCV
AVVGVT

The query sequence (length=326) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6twm:D	328	326	1.0000	0.9939	1.0000	0.0	6twm:A, 6twm:B, 6twm:C, 6twm:E, 6twm:F, 6twm:G, 6twm:I, 6twm:J, 6twm:K
2	3na6:A	329	325	0.8466	0.8389	0.8492	0.0
3	3cdx:A	329	326	0.3896	0.3860	0.3896	4.03e-70	3cdx:B, 3cdx:C, 3cdx:D, 3cdx:E, 3cdx:F
4	8asw:A	1255	164	0.1288	0.0335	0.2561	1.5
5	2hs3:A	602	66	0.0644	0.0349	0.3182	1.7	3d54:A, 3d54:E, 3d54:I, 2hs4:A
6	2hru:A	581	66	0.0644	0.0361	0.3182	1.7	2hry:A, 2hs0:A
7	6qw6:68	95	55	0.0552	0.1895	0.3273	3.0	6ahd:z, 8h6e:6g, 8h6j:6g, 8h6k:6g, 8h6l:6g, 6qx9:68, 8qxd:68, 8r08:68, 8r09:68, 8r0a:68, 8r0b:68, 8rm5:68
8	5mhn:B	685	51	0.0552	0.0263	0.3529	5.7	5mhm:A, 5mhm:B, 5mho:A, 5mho:B
9	4qju:A	90	35	0.0429	0.1556	0.4000	8.5	4qju:B
10	3ieh:A	268	67	0.0675	0.0821	0.3284	9.4
11	6yxx:EC	373	167	0.1319	0.1153	0.2575	9.7	7aoi:XP, 6yxy:EC

[Back]