BioLiP

>protein
KMCMNASCGTTSTVEWKKGWPLRSGLLADLCYRCGSAYESSLFCEQFHKDQSGWRECYLCSKRLHCGCIASKVTIELMDY
GGVGCSTCACCHQLNLNTRGEN

The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5yug:E	102	102	1.0000	1.0000	1.0000	1.11e-72	5yug:A, 5yug:B, 5yug:G, 5yuh:A
2	5z28:B	98	90	0.5784	0.6020	0.6556	1.60e-37	5z28:A
3	3v8x:A	853	51	0.1569	0.0188	0.3137	0.14
4	8qoy:A	1036	47	0.1373	0.0135	0.2979	1.1
5	8dvm:A	612	56	0.2059	0.0343	0.3750	1.6	4a0p:A, 8dvl:A, 8dvn:A
6	7yet:A	999	29	0.1176	0.0120	0.4138	1.7
7	7yes:A	1369	29	0.1176	0.0088	0.4138	1.8	8jsl:A, 8jsm:A, 8jsn:A, 7yer:A
8	7l7b:D	1148	58	0.1765	0.0157	0.3103	2.6
9	8i23:D	1154	75	0.1961	0.0173	0.2667	2.7	8i24:D
10	6lod:E	157	38	0.1275	0.0828	0.3421	3.5	6loe:E
11	8aaf:e	1527	32	0.1275	0.0085	0.4062	4.5	8agt:e, 8agu:e, 8agv:e, 8agw:e, 8agx:e, 8agz:e
12	7aoh:B	1134	81	0.1863	0.0168	0.2346	6.0	7amv:B, 7aof:B, 7aoz:B, 7ap8:B, 7ap9:B, 8c8h:B, 6rfl:B, 6ric:B, 6rid:B, 6rie:B
13	8p0j:B	1155	81	0.1863	0.0165	0.2346	6.0	8p0k:B, 8p0n:B
14	4wxx:B	1178	50	0.1471	0.0127	0.3000	6.8	3epz:A, 3epz:B, 7lmk:A, 7lmk:B, 7lmk:C, 7lmk:D, 7lmm:A, 7lmm:B, 7lmm:C, 7lmm:D, 3pta:A, 7sfc:A, 7sfd:A, 7sfe:A, 7sff:A, 7sfg:A, 5wvo:C, 4wxx:A, 6x9i:A, 6x9j:A, 6x9k:A, 7xi9:A, 7xib:A, 5ydr:B, 4yoc:A

[Back]