BioLiP

>protein
KLVLDLERLAHVPQEKAGPLQRYAATIQSQRGDYNGKVLSIRQDDLRTLAVIYDQSPSVLTEQLISWGVLDA

The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4oay:A	80	72	0.9861	0.8875	0.9861	2.19e-47	5khd:R, 5khd:A, 4oay:M, 4oay:B, 4oay:N, 4oay:K, 4oay:R, 4oay:J, 4oay:D, 4oay:H, 4oay:G, 4oay:E, 4oay:F, 4oaz:R, 4oaz:A, 5tzd:J, 5tzd:B, 5tzd:C, 5tzd:A, 5tzf:J, 5tzf:B, 5tzf:E, 5tzf:D, 5tzf:I, 5tzf:H, 5tzf:N, 5tzf:M, 5tzg:C, 5tzg:A
2	4ba0:A	781	59	0.2639	0.0243	0.3220	0.41	4b9y:A, 4b9z:A, 5i23:A, 5i24:A, 5npb:A, 5npc:A, 5npd:A, 5npe:A, 7p4c:AAA, 7p4d:AAA, 8rw3:C, 8rw3:A, 8rw3:B
3	2nra:C	252	62	0.2917	0.0833	0.3387	1.3
4	8g1e:A	1037	37	0.1667	0.0116	0.3243	1.6	8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D
5	6qfb:C	1011	37	0.1667	0.0119	0.3243	1.7
6	3wdh:A	698	26	0.1528	0.0158	0.4231	8.9	3wdi:A, 3wdj:A

[Back]