KLIDENGRRIDGRKKYELRPIKMEVGVLKNANGSAYIEWGKNKIIAAVYGPRELHPKHLQRPDRAILRVRYNMAPFSVEE
RKKPGPDRRSIEISKVIKGALEPALILEMFPRTAIDVFIEVLQADAGTRVAGITAASLALADAGIPMRDLVAACAAGKIE
GEIVLDLNKEEDNYGEADVPVAIMPLKNDITLLQMDGYLTKDEFIEAVKLAIKGAKAVYQKQREALKEKYLKIAQE
The query sequence (length=236) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2pnz:A | 236 | 236 | 1.0000 | 1.0000 | 1.0000 | 1.27e-171 | 2po0:A, 2po1:A, 2po2:A |
2 | 2c39:D | 248 | 236 | 0.6186 | 0.5887 | 0.6186 | 1.58e-107 | 4ba1:B, 4ba2:B, 2c37:B, 2c37:F, 2c37:N, 2c37:V, 2c37:X, 2c38:B, 2c38:F, 2c38:H, 2c38:J, 2c38:N, 2c38:V, 2c38:X, 2c39:B, 2c39:F, 2c39:H, 2c39:J, 2c39:L, 2c39:N, 2c39:P, 2c39:R, 2c39:T, 2c39:V, 2c39:X, 2jea:B |
3 | 2wnr:B | 222 | 219 | 0.6059 | 0.6441 | 0.6530 | 1.52e-103 | 2wnr:D, 2wnr:F |
4 | 3m7n:E | 248 | 235 | 0.5975 | 0.5685 | 0.6000 | 9.04e-102 | 3m7n:F, 3m7n:D, 3m85:F, 3m85:D, 3m85:E |
5 | 6d6q:B | 241 | 221 | 0.3856 | 0.3776 | 0.4118 | 1.33e-58 | 6d6r:B |
6 | 6fsz:BB | 244 | 233 | 0.3263 | 0.3156 | 0.3305 | 8.56e-31 | 4ifd:B, 5jea:B, 5k36:B, 8qcf:C |
7 | 1r6m:A | 236 | 241 | 0.3220 | 0.3220 | 0.3154 | 1.85e-24 | |
8 | 3dd6:A | 244 | 237 | 0.3178 | 0.3074 | 0.3165 | 2.67e-22 | |
9 | 6d6q:F | 252 | 218 | 0.3178 | 0.2976 | 0.3440 | 5.50e-21 | 6d6r:F |
10 | 4aim:A | 698 | 201 | 0.2966 | 0.1003 | 0.3483 | 1.79e-19 | 4aid:A, 4aid:B, 4aid:C, 4am3:A, 4am3:C, 4am3:B |
11 | 4aim:A | 698 | 183 | 0.1949 | 0.0659 | 0.2514 | 0.006 | 4aid:A, 4aid:B, 4aid:C, 4am3:A, 4am3:C, 4am3:B |
12 | 7ogk:A | 695 | 199 | 0.2797 | 0.0950 | 0.3317 | 1.01e-17 | 3gcm:A, 3gcm:B, 3gcm:C, 3h1c:A, 3h1c:B, 3h1c:C, 3h1c:K, 3h1c:G, 3h1c:I, 3h1c:M, 3h1c:O, 3h1c:R, 3h1c:T, 3h1c:V, 3h1c:X, 7ogk:B, 7ogk:C, 7ogm:L, 7ogm:N, 7ogm:O |
13 | 5yjj:A | 442 | 232 | 0.3136 | 0.1674 | 0.3190 | 1.95e-17 | 5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F |
14 | 5yjj:A | 442 | 219 | 0.1949 | 0.1041 | 0.2100 | 0.006 | 5yjj:B, 5yjj:C, 5yjj:D, 5yjj:E, 5yjj:F |
15 | 3gme:A | 482 | 195 | 0.2669 | 0.1307 | 0.3231 | 6.22e-17 | |
16 | 8wx0:A | 597 | 222 | 0.2881 | 0.1139 | 0.3063 | 6.55e-16 | 8wx0:B, 8wx0:C |
17 | 7ld5:A | 587 | 213 | 0.2754 | 0.1107 | 0.3052 | 6.63e-16 | 7ld5:B, 7ld5:C |
18 | 1e3p:A | 645 | 205 | 0.2712 | 0.0992 | 0.3122 | 9.73e-15 | |
19 | 3m85:I | 259 | 243 | 0.2331 | 0.2124 | 0.2263 | 1.81e-09 | 3m7n:I, 3m7n:G, 3m7n:H, 3m85:G, 3m85:H |
20 | 2pnz:B | 267 | 91 | 0.1144 | 0.1011 | 0.2967 | 2.50e-08 | |
21 | 4ba2:A | 274 | 207 | 0.1949 | 0.1679 | 0.2222 | 5.02e-08 | 2c37:I, 2c37:U, 2c38:G, 2c38:I, 2c38:U, 2c38:W, 2jea:A |
22 | 6d6q:C | 265 | 109 | 0.1144 | 0.1019 | 0.2477 | 8.63e-04 | 6d6r:C |
23 | 6d6q:A | 287 | 63 | 0.0847 | 0.0697 | 0.3175 | 0.11 | 6d6r:A |
24 | 4oo1:E | 255 | 29 | 0.0508 | 0.0471 | 0.4138 | 2.5 | |
25 | 2ybo:A | 248 | 105 | 0.1441 | 0.1371 | 0.3238 | 3.0 | 2ybq:A |
26 | 8a8g:A | 382 | 67 | 0.1059 | 0.0654 | 0.3731 | 3.8 | 8a8d:A, 8a8d:B |
27 | 6dkt:E | 268 | 62 | 0.0678 | 0.0597 | 0.2581 | 6.5 | |
28 | 8th5:I | 119 | 19 | 0.0424 | 0.0840 | 0.5263 | 7.5 |