KKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSK
The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2j2s:A | 72 | 57 | 1.0000 | 0.7917 | 1.0000 | 2.49e-36 | 2jyi:A, 2kkf:A, 4nw3:A |
2 | 4pzi:A | 61 | 48 | 0.5263 | 0.4918 | 0.6250 | 6.17e-15 | |
3 | 5w9q:A | 56 | 48 | 0.4211 | 0.4286 | 0.5000 | 6.84e-09 | 5w9q:B |
4 | 3qmb:A | 54 | 46 | 0.4035 | 0.4259 | 0.5000 | 9.09e-09 | 3qmc:A, 3qmd:A, 3qmg:A, 3qmh:A, 3qmi:A |
5 | 4wxx:B | 1178 | 48 | 0.4211 | 0.0204 | 0.5000 | 1.62e-06 | 3epz:A, 3epz:B, 7lmk:A, 7lmk:B, 7lmk:C, 7lmk:D, 7lmm:A, 7lmm:B, 7lmm:C, 7lmm:D, 3pta:A, 7sfc:A, 7sfd:A, 7sfe:A, 7sff:A, 7sfg:A, 5wvo:C, 4wxx:A, 6x9i:A, 6x9j:A, 6x9k:A, 7xi9:A, 7xib:A, 5ydr:B, 4yoc:A |
6 | 3swr:A | 965 | 45 | 0.4211 | 0.0249 | 0.5333 | 1.93e-06 | |
7 | 3pt6:B | 915 | 45 | 0.4386 | 0.0273 | 0.5556 | 2.62e-06 | 4da4:A, 3pt6:A, 6w8v:A |
8 | 4hp1:C | 51 | 50 | 0.3509 | 0.3922 | 0.4000 | 1.16e-04 | 4hp3:C |
9 | 5exh:C | 45 | 49 | 0.3158 | 0.4000 | 0.3673 | 0.002 | 4z3c:C |
10 | 4bbq:A | 111 | 44 | 0.3684 | 0.1892 | 0.4773 | 0.002 | 4bbq:B |
11 | 4o64:A | 116 | 45 | 0.3684 | 0.1810 | 0.4667 | 0.002 | 4o64:B, 4o64:C |
12 | 5vc9:C | 46 | 52 | 0.3333 | 0.4130 | 0.3654 | 0.003 | 5vc9:F |
13 | 6asd:C | 45 | 48 | 0.3333 | 0.4222 | 0.3958 | 0.026 | |
14 | 6asb:I | 121 | 29 | 0.2456 | 0.1157 | 0.4828 | 0.34 | 6asb:C, 6asb:L |
15 | 6asb:F | 85 | 30 | 0.2456 | 0.1647 | 0.4667 | 0.57 | |
16 | 5w9s:C | 44 | 49 | 0.2807 | 0.3636 | 0.3265 | 0.97 | |
17 | 7evo:D | 200 | 25 | 0.1930 | 0.0550 | 0.4400 | 1.2 | 8hk1:D, 6n3e:A, 6n3f:C, 6nsx:A |
18 | 1oyw:A | 516 | 14 | 0.1579 | 0.0174 | 0.6429 | 5.4 | 1oyy:A |
19 | 4ylf:A | 276 | 29 | 0.1579 | 0.0326 | 0.3103 | 6.3 | 4ylf:C, 4yry:A, 4yry:C |
20 | 4q47:A | 513 | 19 | 0.1404 | 0.0156 | 0.4211 | 8.8 | 4q47:B, 4q48:A, 4q48:B |
21 | 7uu5:A | 379 | 37 | 0.2105 | 0.0317 | 0.3243 | 9.3 | 8e40:A, 8edj:A, 5k81:A, 5k81:B, 5k81:C, 5k81:D, 5k81:E, 5k81:F, 5k82:A, 5k82:B, 5k82:C, 5k82:D, 5k83:C, 5k83:E, 5k83:A, 5k83:D, 5k83:F, 5k83:B, 6p3x:A, 6p3x:B, 6p3y:A, 6p3y:B, 6p3z:A, 6p3z:B, 6p40:A, 6p40:B, 7uu3:A, 7uu3:B, 7uu4:A, 7uu5:B |