KGKKRSGARPGRPQPLRGTKGKRKGARLWYVGGQQF
The query sequence (length=36) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bpa:3 | 36 | 36 | 1.0000 | 1.0000 | 1.0000 | 8.73e-19 | |
2 | 2z06:A | 252 | 26 | 0.3056 | 0.0437 | 0.4231 | 4.4 | 2z06:B, 2z06:C, 2z06:D |
3 | 5eqc:A | 426 | 24 | 0.2778 | 0.0235 | 0.4167 | 5.9 | 5dj9:A, 5dj9:B, 5e3k:A, 5e3k:B, 5e5i:A, 5e5i:B, 5eqc:B, 4nog:A, 4nog:B, 4zlv:A, 4zlv:B, 4zwm:A, 4zwm:B |
4 | 6m64:A | 203 | 13 | 0.1944 | 0.0345 | 0.5385 | 6.4 | 7co1:A, 7co1:C, 7co1:E, 6m64:C, 6m64:E, 5xod:A, 6zvq:A |
5 | 7dry:A | 186 | 31 | 0.3333 | 0.0645 | 0.3871 | 9.4 | 7drz:A, 7ds0:A, 7ds1:A |