KFLEKKLKKIAYERIDILMSLAEEEAKKGNWDRAKRYVYLARRIAMKMRIRFPKKWKRRICKKCGTFLLYGRNARVRIKS
KRYPHVVITCLECGAIYRIPMIREKKEKRRKKLEERLKA
The query sequence (length=119) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6k0b:G | 120 | 119 | 1.0000 | 0.9917 | 1.0000 | 1.17e-80 | 6k0a:G, 6k0a:H, 6k0b:H |
2 | 1x0t:A | 106 | 93 | 0.4622 | 0.5189 | 0.5914 | 9.32e-31 | 2zae:B, 2zae:D |
3 | 2ki7:B | 97 | 96 | 0.4454 | 0.5464 | 0.5521 | 6.22e-29 | 2k3r:A |
4 | 6ahr:K | 121 | 86 | 0.2101 | 0.2066 | 0.2907 | 0.094 | 6ahu:K |
5 | 5c3u:A | 315 | 39 | 0.1176 | 0.0444 | 0.3590 | 0.85 | |
6 | 1ul5:A | 86 | 61 | 0.1681 | 0.2326 | 0.3279 | 1.9 | |
7 | 4wvc:A | 413 | 38 | 0.1176 | 0.0339 | 0.3684 | 2.2 | 4wvc:B |
8 | 5exd:H | 291 | 58 | 0.1597 | 0.0653 | 0.3276 | 5.1 | 5exd:B, 5exd:K, 5exe:E |
9 | 5c4i:E | 312 | 58 | 0.1597 | 0.0609 | 0.3276 | 5.1 | 5c4i:B, 5exd:E, 5exe:B |
10 | 5nqv:C | 190 | 20 | 0.0672 | 0.0421 | 0.4000 | 6.4 | 5nqv:A, 5nqv:B, 5nqv:D |
11 | 5ujm:E | 357 | 38 | 0.0840 | 0.0280 | 0.2632 | 6.9 | |
12 | 6skz:A | 2638 | 29 | 0.1008 | 0.0045 | 0.4138 | 8.8 | 6sl0:A, 6sl0:B |
13 | 6sl1:A | 2652 | 29 | 0.1008 | 0.0045 | 0.4138 | 8.9 | 6sky:A, 6sky:B |