Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
KDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACG
P

The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 6fnz:B 81 81 1.0000 1.0000 1.0000 8.12e-55 6fnz:A, 6fnz:C, 6fnz:D
2 6or5:A 2058 63 0.2099 0.0083 0.2698 1.6
3 5drv:A 131 29 0.1235 0.0763 0.3448 2.9
4 6w1s:I 1077 37 0.1358 0.0102 0.2973 4.1
5 7jrq:A 127 41 0.1605 0.1024 0.3171 4.6
6 5tez:I 202 30 0.1728 0.0693 0.4667 4.7
7 4rhm:A 308 66 0.2222 0.0584 0.2727 6.1 4rhl:A, 4rhl:B, 4rhm:B, 4rhm:C
8 3cob:A 355 48 0.1605 0.0366 0.2708 7.0 3cob:C, 1sdm:A
9 1fa9:A 834 22 0.1481 0.0144 0.5455 8.1 2ati:A, 2ati:B, 3ceh:A, 3ceh:B, 3cej:A, 3cej:B, 3cem:A, 3cem:B, 3dd1:A, 3dd1:B, 3dds:A, 3dds:B, 3ddw:A, 3ddw:B, 8ems:B, 8ems:A, 1fc0:A, 1fc0:B, 1l5q:A, 1l5q:B, 1l5r:A, 1l5r:B, 1l5s:A, 1l5s:B, 1l7x:A, 1l7x:B, 1xoi:A, 1xoi:B, 2zb2:A, 2zb2:B
10 2qll:A 806 22 0.1481 0.0149 0.5455 8.4 1em6:A, 1em6:B, 1exv:A, 1exv:B
11 8hil:A 860 53 0.2099 0.0198 0.3208 8.5 8him:A

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218