BioLiP

>protein
KARMRWTPELHEAFVEAVNSLGGSERATPKGVLKIMKVEGLTIYHVKSHLQKYRTAR

The query sequence (length=57) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6j5b:C	59	57	1.0000	0.9661	1.0000	1.57e-37	6j4r:A, 6j4r:D, 6j4r:B, 6j4r:C, 6j5b:A, 6j5b:D, 6j5b:F, 6j5b:H, 6j5b:J
2	7d3t:D	62	55	0.8246	0.7581	0.8545	2.73e-31	7d3t:A, 7d3t:B, 7d3t:C
3	8xas:C	63	54	0.5439	0.4921	0.5741	9.40e-15	8xas:B, 8xas:D, 8xas:A, 8xas:E, 8xas:F
4	6qec:A	65	54	0.4912	0.4308	0.5185	7.84e-14	5lxu:A
5	1v9p:A	584	40	0.2281	0.0223	0.3250	0.54	1dgs:A, 1dgs:B, 1v9p:B
6	6r0r:A	162	19	0.1404	0.0494	0.4211	2.0	6r0f:A, 6r0f:B, 6r0g:A, 6r0g:B, 6r0p:A, 6r0p:B, 6r0t:A, 6r0t:B
7	5y6p:gy	260	37	0.2281	0.0500	0.3514	2.6	5y6p:gz
8	6ki3:B	300	30	0.2456	0.0467	0.4667	3.0	6khy:A, 6khy:C, 6khy:B, 6khy:D, 6ki3:A
9	6ifh:A	119	25	0.1754	0.0840	0.4000	3.3
10	5z4g:A	145	48	0.3158	0.1241	0.3750	3.5	5z4g:B
11	8phv:C	308	17	0.1754	0.0325	0.5882	6.6	8phd:A, 8phd:C, 8phv:A
12	3s6h:A	436	22	0.1579	0.0206	0.4091	8.6	4kzt:A, 4kzt:B, 4kzt:X, 4kzt:Y, 3s6g:B, 3s6g:Y, 3s6h:X, 3s6h:B, 3s6h:Y
13	7z1u:A	147	22	0.1579	0.0612	0.4091	8.7	7z1u:B, 7zos:A
14	2nya:A	791	14	0.1754	0.0126	0.7143	9.5	2nya:F
15	4odv:H	222	56	0.3509	0.0901	0.3571	9.8
16	8yeo:A	255	18	0.1754	0.0392	0.5556	9.8	8w1p:H, 8ydb:A, 8yh9:A

[Back]