IWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLK
The query sequence (length=76) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8cwr:A | 85 | 76 | 1.0000 | 0.8941 | 1.0000 | 9.93e-53 | 8cwt:A, 8cwt:C, 8cwt:E, 8cyf:A |
2 | 5oay:A | 76 | 72 | 0.4342 | 0.4342 | 0.4583 | 8.61e-14 | 6ono:A, 6ono:C, 6onu:A, 6onu:C, 6onu:E, 6onu:G |
3 | 8dy7:H | 85 | 73 | 0.3816 | 0.3412 | 0.3973 | 2.92e-09 | 8dy9:H |
4 | 7kim:Z | 80 | 30 | 0.1974 | 0.1875 | 0.5000 | 1.06e-04 | 7kif:Z, 7kuf:A, 7kug:A, 7kug:C |
5 | 8d5v:A | 84 | 41 | 0.1842 | 0.1667 | 0.3415 | 0.37 | 8d5v:C |
6 | 8aji:A | 348 | 20 | 0.1316 | 0.0287 | 0.5000 | 3.2 | 8aji:B, 8aji:C, 8aji:D, 8akh:A, 8akh:B |
7 | 5och:C | 537 | 51 | 0.2632 | 0.0372 | 0.3922 | 7.6 | |
8 | 5och:E | 576 | 51 | 0.2632 | 0.0347 | 0.3922 | 8.0 | 7ehl:A, 7ehl:B, 5och:A, 5och:B, 5och:D, 5och:F, 5och:G, 5och:H |