ITVKQTNMENIYECEFNDGSFRLCTRNLVPNFNVYGERLIKYEGVEYREWNAFRSKLAGAILKGLKTNPIRKGTKVLYLG
AASGTTISHVSDIIELNGKAYGVEFSPRVVRELLLVAQRRPNIFPLLADARFPQSYKSVVENVDVLYVDIAQPDQTDIAI
YNAKFFLKVNGDMLLVIKARSIDVTKDPKEIYKTEVEKLENSNFETIQIINLDPYDKDHAIVLSKYK
The query sequence (length=227) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xpl:E | 231 | 227 | 1.0000 | 0.9827 | 1.0000 | 2.87e-169 | 5gin:E, 5gin:F, 5gin:M, 5gio:E, 5gio:F, 5gio:M, 5gip:E, 5gip:F, 5gip:O, 5gip:P, 3id5:B, 3id5:F, 3id6:C, 3pla:E, 3pla:F, 3pla:M, 7xpl:F |
2 | 4df3:A | 230 | 221 | 0.5286 | 0.5217 | 0.5430 | 7.44e-92 | 4df3:B |
3 | 4by9:E | 227 | 221 | 0.5110 | 0.5110 | 0.5249 | 1.31e-79 | 4by9:K, 3nmu:F, 3nmu:J, 3nvk:I, 3nvk:J |
4 | 1g8s:A | 230 | 219 | 0.4802 | 0.4739 | 0.4977 | 4.35e-75 | |
5 | 7mqa:SC | 229 | 227 | 0.4449 | 0.4410 | 0.4449 | 2.24e-69 | 2ipx:A, 7se7:A, 7se8:A, 7se8:B, 7se9:A, 7se9:B, 7sea:A, 7seb:A, 7sec:A, 7sec:B, 7sed:A |
6 | 5oql:S | 237 | 215 | 0.4537 | 0.4346 | 0.4791 | 3.43e-67 | 6rxt:CB, 6rxu:CB, 6rxv:CB, 6rxx:CB, 6rxy:CB, 6rxz:CB |
7 | 7d4i:3B | 242 | 209 | 0.4317 | 0.4050 | 0.4689 | 7.04e-65 | 7aju:CB, 7d4i:3C, 7d5s:3C, 7d5t:3B, 7d5t:3C, 7d63:3C, 6ke6:3C, 6lqp:3C, 6lqq:3C, 6lqr:3C, 6lqs:3C, 6lqt:3C, 6lqu:3C, 6lqv:3C, 7suk:SD, 5wlc:SD, 6zqd:CA, 6zqd:CB |
8 | 1nt2:A | 209 | 188 | 0.3744 | 0.4067 | 0.4521 | 1.66e-49 | |
9 | 3cl5:A | 358 | 87 | 0.1013 | 0.0642 | 0.2644 | 2.5 | |
10 | 3cjt:A | 254 | 72 | 0.1101 | 0.0984 | 0.3472 | 2.6 | 3cjq:A, 3cjq:D, 3cjq:G, 3cjr:A, 3cjt:C, 3cjt:E, 3cjt:G, 3cjt:I, 3cjt:K, 3cjt:M, 3cjt:O, 3egv:A, 2nxe:A, 2nxe:B, 2zbp:A, 2zbq:A, 2zbr:A |
11 | 5jmd:A | 646 | 33 | 0.0529 | 0.0186 | 0.3636 | 3.1 | 5jmf:A |
12 | 8w0t:A | 398 | 134 | 0.1366 | 0.0779 | 0.2313 | 3.3 | 8w0t:B, 8w0t:C, 8w0t:D, 8w0u:A, 8w0u:B, 8w0u:C, 8w0u:D, 8w0z:A, 8w0z:B, 8w0z:C, 8w0z:D, 8w0z:E, 8w0z:F, 8w0z:G, 8w0z:H |
13 | 6kji:A | 351 | 35 | 0.0485 | 0.0313 | 0.3143 | 3.8 | 6kji:B, 6kji:C |
14 | 3o8o:E | 752 | 77 | 0.0969 | 0.0293 | 0.2857 | 4.1 | 3o8o:A, 3o8o:C, 3o8o:G |
15 | 8h9d:A | 1114 | 40 | 0.0749 | 0.0153 | 0.4250 | 4.9 | |
16 | 7rr5:T | 162 | 92 | 0.1233 | 0.1728 | 0.3043 | 6.6 | |
17 | 8oiv:A | 293 | 32 | 0.0529 | 0.0410 | 0.3750 | 7.1 | 1av6:A, 8b07:A, 8b07:B, 1b42:A, 1bky:A, 8ceq:A, 8ceq:B, 8cer:A, 8cer:B, 8ces:A, 8ces:B, 8cet:A, 8cet:B, 8cev:A, 8cev:B, 8cgb:A, 4dcg:A, 1eam:A, 1eqa:A, 3er8:A, 3er8:B, 1jsz:A, 1jte:A, 1jtf:A, 3mag:A, 3mct:A, 8oiv:B, 1p39:A, 1v39:A, 1vp3:A, 1vp9:A, 1vpt:A, 2vp3:A |
18 | 6z0p:A | 242 | 64 | 0.0705 | 0.0661 | 0.2500 | 7.3 | 6z0p:B |
19 | 1ri1:A | 252 | 156 | 0.1410 | 0.1270 | 0.2051 | 8.0 | 2hv9:A, 1ri2:A, 1ri3:A, 1ri4:A, 1z3c:A |
20 | 5thy:A | 387 | 30 | 0.0441 | 0.0258 | 0.3333 | 8.6 | 5thy:B, 5thz:B, 5thz:A |
21 | 3ayi:A | 684 | 44 | 0.0661 | 0.0219 | 0.3409 | 9.8 | 3ayi:B, 3ayj:A, 3ayj:B, 3ayl:A, 3ayl:B, 2yr5:A, 2yr5:B, 2yr6:A, 2yr6:B |