ITRLYTSYFKGELFPNQLARPLERLPRGVSLAAARKGQRPYVPLGEVAKLELQGDYLTEGGLHQEALEYYGVVAKAYELA
YPKDHPQVAGIRLKLAGAFRRTGRLTSSKANCEAVLQMLDSAVQPPLELIVEALFELGLTSEAMSDAAAGTVFEEAVALV
DMFHNSGQSHKMLRLLPRLGRRFNLNFEEKFVYFSPFDYDRVFALADQCLERAEVFYQARNDRAGVMRVLQQRKELIDKK
FFNMRDFAGRIHTMRGHWKRRAQVLTNAPTPDELLRYSPTIHQVYRDFKYELNAPIGREKEVQPGVNRVVHDMGNPYRRS
GVRSQRMFRDAEKNFEKYIRA
The query sequence (length=341) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7am2:Aj | 342 | 342 | 1.0000 | 0.9971 | 0.9971 | 0.0 | 7aih:Aj, 7ane:Aj |
2 | 6yxx:BF | 346 | 344 | 0.7097 | 0.6994 | 0.7035 | 1.07e-167 | 7aoi:BF, 6hiv:BF, 6hix:BF, 6yxy:BF |
3 | 4ap0:C | 311 | 163 | 0.1056 | 0.1158 | 0.2209 | 0.70 | |
4 | 5v4d:A | 127 | 28 | 0.0293 | 0.0787 | 0.3571 | 1.7 | 5v4d:B, 5v4d:E |
5 | 7qce:A | 187 | 107 | 0.0645 | 0.1176 | 0.2056 | 2.1 | 7qce:B |
6 | 4qko:D | 133 | 76 | 0.0557 | 0.1429 | 0.2500 | 6.9 | 4qko:B, 4qko:F, 4qko:H |
7 | 3kb8:A | 201 | 145 | 0.1026 | 0.1741 | 0.2414 | 7.1 | 6d9r:A, 6d9r:B, 6d9s:A, 6d9s:B, 3h83:A, 3h83:B, 3kb8:B |
8 | 6g1q:B | 331 | 49 | 0.0440 | 0.0453 | 0.3061 | 9.2 | 7aqm:A, 7aqm:B, 6g1p:A, 6g1p:B, 6g1q:A, 6hgz:A, 6hgz:B, 6hh3:A, 6hh3:B, 6hh4:A, 6hh4:B, 6hh5:A, 6hh5:B, 6hoz:A, 6hoz:B |