BioLiP

>protein
IRWDVDIIAQSSIVHRDDDTFTLFRREKIIGPDGQILQIPLISGSSFRGVLRRVGEALTAEVLGYEDVALAKSAHPLTDE
EERNLKELLPQIAVFGGAASGRVMSGLLSVSKVLPEIAELAHLLPRPPHSTPLLPAVLSVADESPLGRFAIETLPAGTRL
QTWARLDNATEHQAAFFDNVLSTFAAHGHLGGRSAAGHGQVTATVTATALRGSLPRPTVDWVNQLADD

The query sequence (length=228) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7jhy:e	228	228	1.0000	1.0000	1.0000	3.92e-165	7jhy:d, 7jhy:c, 7jhy:f, 7jhy:b, 7jhy:a
2	7qe7:K	531	71	0.1009	0.0433	0.3239	1.5	5a31:J, 5a31:K, 5g04:J, 5g04:K, 5g05:J, 5g05:K, 9gaw:Q, 9gaw:K, 3hym:B, 3hym:D, 3hym:F, 3hym:H, 3hym:J, 3hym:L, 5lcw:J, 5lcw:K, 8pkp:Q, 8pkp:K, 6q6g:Q, 6q6g:K, 6q6h:Q, 6q6h:K, 7qe7:Q, 8s4g:Q, 8s4g:K, 6tlj:J, 6tlj:K, 6tm5:J, 6tm5:K, 6tnt:J, 6tnt:K, 4ui9:J, 4ui9:K
3	7fco:A	433	51	0.0702	0.0370	0.3137	2.3	7fco:B
4	8hjt:A	197	102	0.1228	0.1421	0.2745	2.4	8hjt:B
5	2bht:A	294	45	0.0614	0.0476	0.3111	5.8	2bhs:A, 2bhs:B, 2bhs:C, 2bhs:D, 2bht:B, 2bht:C, 2bht:D, 2jc3:A, 2jc3:H, 2jc3:B, 2jc3:C, 2jc3:D, 2jc3:E, 2jc3:F, 2jc3:G, 2v03:A
6	8wpe:A	1006	137	0.1535	0.0348	0.2555	8.8	8hg1:A, 8hpa:A, 8j86:A, 8j8f:A, 8j8g:A, 8k8s:A, 8k8u:A, 5n2g:A, 8wpf:A, 8wpk:A, 8wpp:A

[Back]