IPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQCFYNSSYLNV
QRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLSFYADKPETTKEQLGEFYEALDCLRIPRSDVMYTDWK
KDKCEPLEKQHEKER
The query sequence (length=175) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3apx:A | 179 | 175 | 1.0000 | 0.9777 | 1.0000 | 2.77e-133 | 3apv:A, 3apv:B, 3apw:A, 3apw:B, 7oub:B |
2 | 3kq0:A | 175 | 174 | 0.8800 | 0.8800 | 0.8851 | 2.29e-117 | |
3 | 5ft8:A | 401 | 54 | 0.1143 | 0.0499 | 0.3704 | 0.43 | 5ft4:A, 5ft4:B, 5ft5:A, 5ft5:B, 5ft6:A, 5ft6:B, 5ft8:C, 5ft8:E, 5ft8:G, 5ft8:I, 5ft8:K, 5ft8:M, 5ft8:O, 4lw2:A, 4lw2:B, 4lw2:C, 4lw4:A, 4lw4:B |
4 | 4gah:B | 195 | 55 | 0.0800 | 0.0718 | 0.2545 | 0.96 | 4gah:A |
5 | 5x4z:N | 1074 | 75 | 0.1371 | 0.0223 | 0.3200 | 3.0 | 5x4z:B, 5x51:B, 5x51:N |
6 | 8u9r:B | 1060 | 71 | 0.1257 | 0.0208 | 0.3099 | 3.4 | 8u9x:B |
7 | 5u7x:F | 412 | 48 | 0.1143 | 0.0485 | 0.4167 | 7.9 | |
8 | 5gqv:A | 755 | 32 | 0.0571 | 0.0132 | 0.3125 | 8.8 | 5gqx:A, 5gqy:A, 5gr1:A, 5gr4:A |