BioLiP

>protein
IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLN
KRIRYLYKHFNRHGKF

The query sequence (length=96) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7a5f:i3	97	96	1.0000	0.9897	1.0000	1.34e-67	7a5g:i3, 7a5h:i, 7a5i:i3, 7a5j:i, 7a5k:i3, 8any:i, 6i9r:i, 3j7y:i, 3j9m:i, 8k2a:Ly, 8k2b:Ly, 7l08:i, 7l20:i, 6nu2:i, 6nu3:i, 7o9k:i, 7o9m:i, 7odr:i, 7ods:i, 7odt:i, 7of0:i, 7of2:i, 7of3:i, 7of4:i, 7of5:i, 7of6:i, 7of7:i, 7og4:i, 7oi6:i, 7oi7:i, 7oi8:i, 7oi9:i, 7oia:i, 7oib:i, 7oic:i, 7oid:i, 7oie:i, 8oir:Bz, 8oit:Bz, 5ool:i, 5oom:i, 7pd3:i, 8pk0:i, 7po4:i, 7qh6:i, 7qh7:i, 7qi4:i, 7qi5:i, 7qi6:i, 8qsj:i, 8qu5:i, 6vlz:i, 6vmi:i, 8xt0:Ly, 8xt1:Ly, 8xt2:Ly, 8xt3:Ly, 6zm5:i, 6zm6:i, 6zs9:i, 6zsa:i, 6zsb:i, 6zsc:i, 6zsd:i, 6zse:i, 6zsg:i
2	5aj4:Bn	97	94	0.8750	0.8660	0.8936	3.55e-60	6gaw:Bn, 6gb2:Bn, 7nqh:Bn, 7nql:Bn, 7nsh:Bn, 7nsi:Bn, 7nsj:Bn, 8oin:Bz, 8oiq:Bz, 6ydp:Bn, 6ydw:Bn
3	8st7:A	212	46	0.1667	0.0755	0.3478	5.9	8st7:C
4	8d49:A	1072	34	0.1458	0.0131	0.4118	7.8
5	7dvq:R	241	31	0.0938	0.0373	0.2903	8.4
6	8wr4:B	1442	60	0.1875	0.0125	0.3000	8.5
7	8wmm:B	1212	60	0.1875	0.0149	0.3000	8.5	8iyq:A, 8wmh:A, 8wmm:A, 8wmn:A, 8wmn:B, 8wr4:A
8	8d4a:A	1207	34	0.1458	0.0116	0.4118	8.8	8d4b:A
9	6wqc:A	293	72	0.1771	0.0580	0.2361	9.5	6wqb:A

[Back]