BioLiP

>protein
IGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLN
KRIRYLYKHFNRH

The query sequence (length=93) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7a5f:i3	97	93	1.0000	0.9588	1.0000	2.86e-65	7a5g:i3, 7a5h:i, 7a5i:i3, 7a5j:i, 7a5k:i3, 8any:i, 6i9r:i, 3j7y:i, 3j9m:i, 8k2a:Ly, 8k2b:Ly, 7l08:i, 7l20:i, 6nu2:i, 6nu3:i, 7o9k:i, 7o9m:i, 7odr:i, 7ods:i, 7odt:i, 7of0:i, 7of2:i, 7of3:i, 7of4:i, 7of5:i, 7of6:i, 7of7:i, 7og4:i, 7oi6:i, 7oi7:i, 7oi8:i, 7oi9:i, 7oia:i, 7oib:i, 7oic:i, 7oid:i, 7oie:i, 8oir:Bz, 8oit:Bz, 5ool:i, 5oom:i, 7pd3:i, 8pk0:i, 7po4:i, 7qh6:i, 7qh7:i, 7qi4:i, 7qi5:i, 7qi6:i, 8qsj:i, 8qu5:i, 6vlz:i, 6vmi:i, 8xt0:Ly, 8xt1:Ly, 8xt2:Ly, 8xt3:Ly, 6zm5:i, 6zm6:i, 6zs9:i, 6zsa:i, 6zsb:i, 6zsc:i, 6zsd:i, 6zse:i, 6zsg:i
2	5aj4:Bn	97	91	0.8817	0.8454	0.9011	1.84e-58	6gaw:Bn, 6gb2:Bn, 7nqh:Bn, 7nql:Bn, 7nsh:Bn, 7nsi:Bn, 7nsj:Bn, 8oin:Bz, 8oiq:Bz, 6ydp:Bn, 6ydw:Bn
3	8st7:A	212	46	0.1720	0.0755	0.3478	4.9	8st7:C
4	5b5m:L	280	11	0.0860	0.0286	0.7273	6.8	5b5m:x, 5b5n:L, 5b5n:x, 7c52:L, 1eys:L, 4v8k:AL, 4v8k:BL, 7vrj:L, 8wdu:L, 8wdv:L, 3wmm:L, 5y5s:L
5	8d49:A	1072	34	0.1505	0.0131	0.4118	7.0
6	7dvq:R	241	31	0.0968	0.0373	0.2903	7.3
7	8wmm:B	1212	60	0.1935	0.0149	0.3000	7.5	8iyq:A, 8wmh:A, 8wmm:A, 8wmn:A, 8wmn:B, 8wr4:A
8	8wr4:B	1442	60	0.1935	0.0125	0.3000	7.5
9	8d4a:A	1207	34	0.1505	0.0116	0.4118	7.8	8d4b:A
10	6wqc:A	293	72	0.1828	0.0580	0.2361	8.9	6wqb:A
11	5e02:A	964	70	0.1935	0.0187	0.2571	9.8

[Back]