IEMLKTLPPTLREKKRYIAFKILYDEELKEGEVVNLIRKAVLEYYGSWGTSKANPWLVYYDFPYGILRCQRDNVDYVKAS
LILIREFKEKPVNIICLGVSGTIRKAKIKFLGIKKPKRWFVIRRER
The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6k0a:A | 126 | 126 | 1.0000 | 1.0000 | 1.0000 | 1.62e-88 | 6k0a:B, 6k0b:A, 6k0b:B |
2 | 6w6v:E | 169 | 124 | 0.2619 | 0.1953 | 0.2661 | 2.18e-04 | 6agb:E, 6ah3:E, 7c79:E, 7c7a:E |
3 | 3uow:B | 477 | 65 | 0.1508 | 0.0398 | 0.2923 | 0.59 | |
4 | 3wwh:A | 329 | 63 | 0.1270 | 0.0486 | 0.2540 | 0.84 | 5fr9:A, 5fr9:B, 5fr9:C, 5fr9:D, 5fr9:E, 5fr9:F, 5fr9:G, 5fr9:H, 5fr9:I, 5fr9:J, 5fr9:K, 5fr9:L, 3wwi:A, 3wwi:B, 3wwi:C, 3wwi:D, 3wwi:E, 3wwi:F, 3wwi:G, 3wwi:H, 3wwi:I, 3wwi:J, 3wwi:K, 3wwi:L, 3wwj:A, 3wwj:B, 3wwj:C, 3wwj:D, 3wwj:E, 3wwj:F, 3wwj:G, 3wwj:H, 3wwj:I, 3wwj:J, 3wwj:K, 3wwj:L |
5 | 2qby:A | 366 | 33 | 0.1032 | 0.0355 | 0.3939 | 2.3 | |
6 | 8kde:A | 309 | 70 | 0.1190 | 0.0485 | 0.2143 | 3.6 | 8r2i:A, 8zee:A |
7 | 6kac:A | 336 | 70 | 0.1190 | 0.0446 | 0.2143 | 4.4 | 8c29:A, 8c29:a, 8iwh:A, 8iwh:a, 8j5k:A, 8j5k:a, 6jlu:A, 6jlu:a, 6kac:a, 6kad:A, 6kad:a, 6kaf:a, 6kaf:A, 5mdx:a, 7oui:A, 7oui:a, 5xnl:A, 5xnl:a, 5xnm:A, 5xnm:a, 6yp7:a, 6yp7:A |
8 | 4wio:A | 525 | 67 | 0.1587 | 0.0381 | 0.2985 | 5.0 | 3uow:A |