IDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIKLHQ
The query sequence (length=53) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8hih:G | 57 | 53 | 1.0000 | 0.9298 | 1.0000 | 1.24e-33 | 6ccv:T, 5tw1:T, 5vi8:T, 6vvs:T, 6vvv:T |
2 | 8dy9:B | 319 | 51 | 0.7925 | 0.1317 | 0.8235 | 3.56e-24 | |
3 | 3iyd:A | 322 | 48 | 0.5283 | 0.0870 | 0.5833 | 6.38e-14 | 6b6h:I, 7beg:B, 7c17:A, 7c97:K, 7chw:K, 5ciz:B, 7dy6:K, 8ftd:R, 8igr:G, 7khc:A, 7khc:B, 1lb2:B, 1lb2:E, 7mkd:R, 7mkj:R, 3n4m:B, 3n4m:C, 6n4c:A, 6n4c:B, 3n97:B, 3n97:C, 6oul:R, 6psq:M, 6psr:M, 6pss:M, 6pst:M, 6psu:M, 6psv:M, 6psw:M, 8tom:M, 8u3b:A, 7w5x:A, 7w5y:A, 8y6u:I |
4 | 7ye1:A | 307 | 48 | 0.4151 | 0.0717 | 0.4583 | 3.43e-11 | 7ye2:A |
5 | 2g37:B | 300 | 37 | 0.2830 | 0.0500 | 0.4054 | 0.16 | 2ekg:A, 2ekg:B, 2g37:A, 5m42:A |
6 | 2g37:B | 300 | 35 | 0.2453 | 0.0433 | 0.3714 | 7.6 | 2ekg:A, 2ekg:B, 2g37:A, 5m42:A |
7 | 6lbr:A | 519 | 46 | 0.3208 | 0.0328 | 0.3696 | 1.5 | 6lbr:B |
8 | 1o5k:A | 295 | 41 | 0.2453 | 0.0441 | 0.3171 | 2.3 | |
9 | 8hkr:B | 384 | 27 | 0.1887 | 0.0260 | 0.3704 | 5.9 | 8hkr:A |
10 | 5tr1:A | 606 | 13 | 0.1509 | 0.0132 | 0.6154 | 8.2 | 5tr1:B |