ICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLC
The query sequence (length=68) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1utr:A | 68 | 68 | 1.0000 | 1.0000 | 1.0000 | 8.94e-45 | 1utr:B |
2 | 2ejn:A | 146 | 69 | 0.2941 | 0.1370 | 0.2899 | 0.012 | 2ejn:B |
3 | 6y3z:P | 348 | 35 | 0.2059 | 0.0402 | 0.4000 | 0.095 | |
4 | 8e9h:D | 407 | 48 | 0.2647 | 0.0442 | 0.3750 | 0.74 | 8e9g:D |
5 | 1xqp:A | 252 | 66 | 0.2647 | 0.0714 | 0.2727 | 3.9 | |
6 | 8jal:B | 573 | 45 | 0.2353 | 0.0279 | 0.3556 | 5.7 | 8jal:A, 8jaq:A, 8jaq:B, 8jaq:J, 8jaq:K, 8jar:A, 8jar:B, 8jas:A, 8jas:B, 8jas:K, 8jas:J, 8jau:A, 8jau:B, 8jav:A, 8jav:B, 8jav:J, 8jav:K |
7 | 3iuu:A | 494 | 24 | 0.1324 | 0.0182 | 0.3750 | 6.5 | |
8 | 3q87:A | 122 | 32 | 0.1912 | 0.1066 | 0.4062 | 6.6 | |
9 | 6co9:A | 295 | 21 | 0.1471 | 0.0339 | 0.4762 | 8.1 | 6coj:A |
10 | 8q7d:p | 441 | 39 | 0.1618 | 0.0249 | 0.2821 | 8.5 | 8qek:p, 8qek:D |