BioLiP

>protein
HTVVLTVTGEPCHFPFQYHRQLYHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLE

The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7prj:A	55	55	1.0000	1.0000	1.0000	1.23e-37
2	1gxd:A	624	53	0.4364	0.0385	0.4528	5.11e-12	1ck7:A, 1eak:A, 1eak:B, 1eak:D, 1eak:C, 1gen:A, 1gxd:B, 1rtg:A
3	1gxd:A	624	54	0.3818	0.0337	0.3889	3.47e-10	1ck7:A, 1eak:A, 1eak:B, 1eak:D, 1eak:C, 1gen:A, 1gxd:B, 1rtg:A
4	1gxd:A	624	48	0.3636	0.0321	0.4167	4.56e-09	1ck7:A, 1eak:A, 1eak:B, 1eak:D, 1eak:C, 1gen:A, 1gxd:B, 1rtg:A
5	5e4l:A	428	53	0.4182	0.0537	0.4340	5.43e-12
6	5e4l:B	386	53	0.4182	0.0596	0.4340	6.80e-12
7	5e4k:A	424	53	0.4182	0.0542	0.4340	6.93e-12
8	1l6j:A	405	46	0.4182	0.0568	0.5000	1.54e-11
9	1l6j:A	405	48	0.4000	0.0543	0.4583	2.44e-11
10	1l6j:A	405	48	0.4000	0.0543	0.4583	1.05e-10
11	3m7p:A	301	58	0.4545	0.0831	0.4310	1.11e-10
12	3m7p:A	301	48	0.3636	0.0664	0.4167	4.02e-10
13	5xts:A	460	53	0.3636	0.0435	0.3774	4.95e-09	5xtw:A, 5xtw:C, 5xtw:D, 5xtw:E, 5xtw:F, 5xtw:H
14	1h8p:A	88	42	0.3273	0.2045	0.4286	2.17e-06	1h8p:B
15	1h8p:A	88	46	0.3091	0.1932	0.3696	0.11	1h8p:B
16	5ch7:B	329	38	0.2727	0.0456	0.3947	0.24	5ch7:D, 5ch7:F, 5chc:B, 5chc:D, 5chc:F, 5e7o:B, 5e7o:D, 5e7o:F, 5e7o:H, 5e7o:J, 5e7o:L, 4ydd:B, 4ydd:D, 4ydd:F
17	6o0g:B	530	44	0.2909	0.0302	0.3636	0.26	5eso:A, 6o0n:C, 6o0n:D
18	8j4u:B	401	36	0.2000	0.0274	0.3056	0.62	8j4u:A, 8j4u:C, 8j4u:D, 8j4u:E, 8j4u:F, 8j4u:G, 8j4u:H, 8j4u:I, 8j4u:J, 8j4u:K, 8j4u:L, 8su9:A, 8su9:B, 8su9:C, 8su9:D, 8su9:E, 8su9:F, 8su9:G, 8su9:H, 8su9:I, 8su9:J, 8su9:K, 8su9:L, 8sub:A, 8sub:B, 8sub:C, 8sub:D, 8sub:E, 8sub:F, 8sub:G, 8sub:H, 8sub:I, 8sub:J, 8sub:K, 8sub:L, 8suw:A, 8suw:B, 8suw:C, 8suw:D, 8suw:E, 8suw:F, 8suw:G, 8suw:H, 8suw:I, 8suw:J, 8suw:K, 8suw:L, 8sxx:A, 8sxx:B, 8sxx:C, 8sxx:D, 8sxx:E, 8sxx:F, 8sxx:G, 8sxx:H, 8sxx:I, 8sxx:J, 8sxx:K, 8sxx:L, 8uae:A, 8uae:B, 8uae:C, 8uae:D, 8uae:E, 8uae:F, 8uae:G, 8uae:H, 8uae:I, 8uae:J, 8uae:K, 8uae:L, 8uaf:A, 8uaf:B, 8uaf:C, 8uaf:D, 8uaf:E, 8uaf:F, 8uaf:G, 8uaf:H, 8uaf:I, 8uaf:J, 8uaf:K, 8uaf:L
19	5ess:A	551	48	0.2909	0.0290	0.3333	1.3	5esd:A, 5esd:B, 5esd:C, 5esd:D, 5eso:D, 5eso:B, 5eso:C, 5ess:B, 5ess:C, 5ess:D, 5esu:A, 5esu:B, 5esu:C, 5esu:D, 6o04:A, 6o04:D, 6o04:B, 6o04:C, 6o0g:A, 6o0g:D, 6o0g:C, 6o0j:A, 6o0j:D, 6o0j:B, 6o0j:C, 6o0n:A, 6o0n:B
20	1wu5:A	376	23	0.2000	0.0293	0.4783	1.5	1wu6:A
21	1dgj:A	906	19	0.1455	0.0088	0.4211	1.7
22	6pmp:C	617	20	0.1818	0.0162	0.5000	4.0	6pmp:A, 6pmp:B, 6pmp:D
23	4ijd:A	215	18	0.1636	0.0419	0.5000	4.0	4ijd:B, 6nm4:A, 6nm4:B
24	6egv:B	239	24	0.2000	0.0460	0.4583	5.5	6egx:B, 6eh1:B, 6eiw:B, 5lsf:B, 5oyp:B
25	2pv0:B	347	27	0.2000	0.0317	0.4074	6.2	2pv0:A, 2pv0:C, 2pvc:B, 2pvc:A, 2pvc:C
26	7dfa:A	363	14	0.1636	0.0248	0.6429	7.1	8as2:A, 8as3:A, 7df9:A, 7dfb:A, 7dfc:A, 8go8:A, 8go8:B, 8gp3:A, 8gp3:B, 8hsv:A, 8hsv:B, 8i0n:B, 8i0n:A, 8i0q:B, 8i0q:A, 8j8z:A, 8j8z:B, 4jqi:A, 8jrv:A, 6ni2:B, 7r0j:C, 6up7:B, 8wrz:A, 1zsh:A
27	7am2:BU	463	32	0.1818	0.0216	0.3125	7.3
28	8j8v:A	365	19	0.1636	0.0247	0.4737	7.5	8go9:A, 8go9:F, 8goc:A, 8goc:B, 8goc:C, 8goo:A, 8goo:B, 8goo:C, 8i0z:A, 8i0z:B, 8i0z:C, 8i10:A, 8i10:B, 8i10:C, 8j8r:A, 8j8r:B, 8j8r:C, 8j8v:F, 6k3f:A, 6k3f:B, 6k3f:C, 6k3f:D, 6k3f:E, 6k3f:F, 5tv1:A
29	4c1q:A	173	18	0.1455	0.0462	0.4444	9.6	4c1q:B
30	4g7a:B	225	21	0.1273	0.0311	0.3333	9.8	4g7a:A

[Back]