HTKSVYDNGETLDISLPIHPKSHIPQGKQDRWVVKLPDFLDINAEPFDPRPFEMNVKTHEDKNQELLDKLIAVNTVRWRY
AKSETGGIFKETNSQIIQWEDGTYSLRVGSEIFDMFTTNTDDNYLVSEHNEEGILMTESTLSKSVKLVPASFQSTTHQKL
AKALSAKQKKESYARSVVTKEDPEERQRRLESQENERYRLERRRKQAE
The query sequence (length=208) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xn7:u | 208 | 208 | 1.0000 | 1.0000 | 1.0000 | 5.43e-157 | 7xse:u, 7xsx:u, 7xt7:u, 7xti:u |
2 | 4m6t:A | 177 | 91 | 0.1779 | 0.2090 | 0.4066 | 3.39e-17 | |
3 | 7x2e:A | 163 | 130 | 0.1779 | 0.2270 | 0.2846 | 0.80 | 2kbs:A |
4 | 8jnp:A | 390 | 86 | 0.1202 | 0.0641 | 0.2907 | 0.97 | 8jnq:A |
5 | 1hm8:A | 458 | 67 | 0.0913 | 0.0415 | 0.2836 | 2.4 | 4aaw:A, 4ac3:A, 1g97:A, 1hm8:B, 1hm9:A, 1hm9:B, 7kr9:A |
6 | 3zqe:A | 272 | 51 | 0.0865 | 0.0662 | 0.3529 | 4.7 | 7agx:2F, 7agx:2K |
7 | 2a9g:D | 406 | 104 | 0.1250 | 0.0640 | 0.2500 | 6.2 | 2a9g:A, 2a9g:B, 2a9g:C |
8 | 7ckq:C | 1061 | 92 | 0.1202 | 0.0236 | 0.2717 | 7.7 | |
9 | 6wvj:C | 1117 | 92 | 0.1202 | 0.0224 | 0.2717 | 7.7 | |
10 | 7f75:C | 1133 | 92 | 0.1202 | 0.0221 | 0.2717 | 8.1 |