HMTLAKVFSQKLRELGISSIYIGHERPSLQSLAIKMLLKNYGLVEERREGMLITQDHGIKLISGKGTETSRYTFRKGGKK
VSIHLPEYPKMVIDLGLFEFLNEEEKEKTLLQVDLCLSVIRKFLWDGNLTVVGKADYVLGRANIVQSLSLSDEDNPVILD
PYGDVVATDQILRDHNVFVIGGRLALSRGYSFPRVKIQLRGSIIGVPDEINKILEIILRVKELDQSLEEAIISLQSKSDK
ISRLLHDVQLYGMEVLEEEARWLRADDKVIEIVRSRLG
The query sequence (length=278) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5a7y:B | 278 | 278 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 5a7y:A |
2 | 6emu:A | 170 | 174 | 0.1691 | 0.2765 | 0.2701 | 1.03e-10 | 6emu:B, 6emu:C, 6emv:A, 6emv:B, 6emv:C |
3 | 3emq:A | 331 | 97 | 0.1007 | 0.0846 | 0.2887 | 2.8 | 3emz:A |
4 | 5usf:A | 682 | 74 | 0.0576 | 0.0235 | 0.2162 | 3.8 | 3p0h:A, 3p0i:A, 3p0j:C, 3p0j:D, 5usf:B |
5 | 6kyf:A | 137 | 76 | 0.0827 | 0.1679 | 0.3026 | 4.0 | |
6 | 2wib:A | 261 | 26 | 0.0396 | 0.0421 | 0.4231 | 6.0 | 2wib:B, 2wic:A |
7 | 1gy8:C | 370 | 53 | 0.0647 | 0.0486 | 0.3396 | 6.6 | 2cnb:A, 2cnb:B, 2cnb:C, 2cnb:D, 1gy8:A, 1gy8:B, 1gy8:D |
8 | 7yfl:B | 679 | 54 | 0.0647 | 0.0265 | 0.3333 | 7.0 | 7yfl:D |
9 | 6l8u:C | 229 | 61 | 0.0683 | 0.0830 | 0.3115 | 7.4 | 6l8u:A, 6l8u:B, 6l8u:D |
10 | 8e96:D | 691 | 54 | 0.0647 | 0.0260 | 0.3333 | 7.7 | 8e96:B |
11 | 7yfr:B | 643 | 54 | 0.0647 | 0.0280 | 0.3333 | 8.1 | 7yfr:D |
12 | 7yff:B | 740 | 54 | 0.0647 | 0.0243 | 0.3333 | 8.2 | 7yff:D |
13 | 7slp:B | 321 | 52 | 0.0647 | 0.0561 | 0.3462 | 9.4 | 6d12:A, 6d12:B, 7slq:B, 4wkr:A, 4wkr:B |
14 | 5zmu:D | 287 | 53 | 0.0612 | 0.0592 | 0.3208 | 9.8 | 5zmu:A, 5zmu:B, 5zmu:C, 5zmy:A, 5zmy:B, 5zmy:C, 5zmy:D, 5zmy:E, 5zmy:F, 5zmy:G, 5zmy:H |