HMSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEA
NAA
The query sequence (length=83) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5fvl:A | 83 | 83 | 1.0000 | 1.0000 | 1.0000 | 1.58e-56 | 5fvk:A, 5fvk:B, 5fvl:B, 4niq:A, 4niq:B |
2 | 4u7y:A | 83 | 81 | 0.4458 | 0.4458 | 0.4568 | 2.17e-14 | 2jqk:A |
3 | 2k3w:A | 73 | 69 | 0.3976 | 0.4521 | 0.4783 | 3.64e-13 | 2jq9:A |
4 | 2ymb:D | 231 | 69 | 0.2651 | 0.0952 | 0.3188 | 3.34e-09 | 4a5x:A, 4a5x:B, 2ymb:C |
5 | 1chm:A | 401 | 34 | 0.1566 | 0.0324 | 0.3824 | 0.62 | 1chm:B |
6 | 6enz:A | 487 | 43 | 0.1687 | 0.0287 | 0.3256 | 0.91 | 6enz:B |
7 | 4v7e:BY | 138 | 64 | 0.2289 | 0.1377 | 0.2969 | 3.7 | 8ip8:ba, 8ip9:ba, 8ipa:ba, 8ipb:ba, 8jiw:BY, 4v3p:SU |
8 | 6gne:B | 494 | 28 | 0.1566 | 0.0263 | 0.4643 | 4.4 | 6gne:A |
9 | 6dql:A | 227 | 50 | 0.1807 | 0.0661 | 0.3000 | 6.8 | |
10 | 6p2l:A | 685 | 59 | 0.2169 | 0.0263 | 0.3051 | 8.3 | |
11 | 5mul:A | 378 | 49 | 0.1928 | 0.0423 | 0.3265 | 9.2 |