HHHMSQEITLGNIKIGGNNPVFIIAEAGLNHGGDLNLALRMIDEAADAKANAIKFQAYNSEERFGENKEAVNLVKPAEFG
KKEFLLLKERSQKKNILFFATPFDVPNLNMLKEIGVEILKIASCDICNITLLEAAADSGLIVILSRGTASASEIETAVSI
FKKKKSPFILLHCVSSYPMNEIDANLSAIQTLKSKYEFPIGYSDHSKGIEIPLLAVASGAEIIEKHYTVDRTLQGIDWEI
SAEPKELAKLVTETERIRKILGHGKLEPQASEQEEIEYRNSLRRK
The query sequence (length=285) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ncs:A | 285 | 285 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 6ncs:B |
2 | 1vli:A | 358 | 264 | 0.3123 | 0.2486 | 0.3371 | 4.90e-35 | |
3 | 4ipi:A | 351 | 259 | 0.2737 | 0.2222 | 0.3012 | 1.95e-28 | 4ipj:A, 6ppw:A, 6ppy:A, 6ppz:A, 2wqp:A, 1xuu:A, 1xuz:A |
4 | 8h2c:A | 342 | 275 | 0.3088 | 0.2573 | 0.3200 | 5.16e-28 | 8h2c:B, 8h2c:C, 8h2c:D |
5 | 3g8r:B | 336 | 188 | 0.2281 | 0.1935 | 0.3457 | 2.24e-21 | |
6 | 7z0h:I | 110 | 47 | 0.0526 | 0.1364 | 0.3191 | 1.4 | 8bws:I, 6cnb:I, 6cnc:I, 6cnd:I, 6cnf:I, 6eu0:I, 6eu1:I, 6eu2:I, 6eu3:I, 6f40:I, 6f41:I, 6f42:I, 5fj8:I, 6tut:I, 7z1l:I, 7z1m:I, 7z1o:I, 7z2z:I, 7z30:I, 7z31:I |
7 | 7b04:B | 1120 | 89 | 0.0842 | 0.0214 | 0.2697 | 5.7 | 7b04:E, 7b04:H, 7b04:K, 7b04:N, 7b04:Q, 7b04:T, 7b04:W |
8 | 4k46:A | 214 | 55 | 0.0561 | 0.0748 | 0.2909 | 7.6 |