HHHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPLSPAECRAIGKSIAKYTHRKFSPEGFSAVQ
AARGRKGGTKSKRAAVPTSARSLKPWEALGISRATYYRKLKC
The query sequence (length=122) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3vw4:A | 122 | 122 | 1.0000 | 1.0000 | 1.0000 | 1.82e-88 | 3vw4:B |
2 | 5w7m:A | 273 | 59 | 0.1475 | 0.0659 | 0.3051 | 0.23 | |
3 | 7nh7:A | 295 | 82 | 0.1885 | 0.0780 | 0.2805 | 0.82 | |
4 | 2faq:A | 295 | 73 | 0.1639 | 0.0678 | 0.2740 | 1.4 | 2faq:B, 2far:A, 2far:B |
5 | 3gwj:D | 674 | 48 | 0.1066 | 0.0193 | 0.2708 | 5.6 | 3gwj:A, 3gwj:F, 3gwj:B, 3gwj:E, 3gwj:C |
6 | 7xx4:A | 395 | 57 | 0.1557 | 0.0481 | 0.3333 | 7.2 | 2iyf:A, 2iyf:B, 4m83:A, 4m83:B, 7xx4:B |
7 | 7xzh:B | 730 | 32 | 0.0738 | 0.0123 | 0.2812 | 8.9 | 7m19:C, 7xzh:A, 7xzh:C, 7xzh:D, 7xzh:E, 7xzh:F |
8 | 7uor:A | 379 | 29 | 0.0902 | 0.0290 | 0.3793 | 9.1 | 1f4t:A, 1f4t:B, 1f4u:A, 1f4u:B, 1io7:A, 1io7:B, 1io8:A, 1io8:B, 1io9:A, 1io9:B, 4tt5:A, 4tuv:A, 7uor:B, 7uor:C, 7uor:D, 7uor:E, 7uor:F, 4wpd:A, 4wpd:B, 4wqj:A |