BioLiP

>protein
HHHHHMMWKPGDECFALYWEDNKFYRAEVEALHSSGMTAVVKFIDYGNYEEVLLSNIKPI

The query sequence (length=60) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5yj8:A	60	60	1.0000	1.0000	1.0000	1.51e-41	8jtn:A, 2lto:A, 6v9t:AAA, 6v9t:BBB
2	4a4f:A	64	53	0.3833	0.3594	0.4340	3.34e-08	4a4h:A, 8poi:A
3	4a4e:A	64	56	0.3667	0.3438	0.3929	4.60e-07	4a4g:A, 4qq6:A, 7w2p:A, 7w30:A, 7w30:B, 7w30:C, 7w30:D
4	5m9n:A	202	50	0.3500	0.1040	0.4200	1.23e-06	5m9n:B
5	4b9w:A	196	50	0.3333	0.1020	0.4000	8.88e-05	4b9w:B
6	3nth:A	167	41	0.2833	0.1018	0.4146	0.002	3nti:A
7	7cfd:F	182	49	0.3333	0.1099	0.4082	0.31	7cfd:B, 7cfd:A, 7cfd:C, 7cfd:E, 7cfd:G, 7cfd:H, 7cfd:D
8	5yz9:A	99	25	0.1833	0.1111	0.4400	0.39
9	7epw:A	373	53	0.2500	0.0402	0.2830	0.57	4a6n:A, 4a6n:B, 4a6n:C, 4a6n:D, 4a99:A, 4a99:C, 4a99:B, 4a99:D, 7epv:A, 4guv:A, 4guv:B, 4guv:C, 4guv:D, 3p9u:A, 3p9u:B, 3p9u:C, 3p9u:D, 3v3n:A, 3v3n:B, 3v3n:C, 3v3n:D, 3v3o:A, 3v3o:B, 3v3o:C, 3v3o:D, 2xdo:A, 2xdo:B, 2xdo:C, 2xdo:D, 2xyo:A, 2xyo:B, 2xyo:C, 2xyo:D, 2y6q:A, 2y6q:B, 2y6q:C, 2y6q:D, 2y6r:A, 2y6r:B, 2y6r:C, 2y6r:D
10	7xmw:B	72	57	0.2500	0.2083	0.2632	1.2	7xmw:A
11	8er0:A	371	50	0.2500	0.0404	0.3000	1.7	8er0:B, 8er1:A, 6wg9:A, 6wg9:B
12	7ase:s	295	49	0.2333	0.0475	0.2857	3.2
13	7smk:B	107	27	0.2000	0.1121	0.4444	4.1	7snv:B
14	1e59:A	239	45	0.2333	0.0586	0.3111	4.2
15	7qh8:A	471	37	0.1667	0.0212	0.2703	5.0	7qhn:A, 7qi8:A
16	3ueq:A	632	19	0.1667	0.0158	0.5263	5.3	4fls:A, 1jg9:A, 1jgi:A, 1mvy:A, 1mw0:A, 1mw1:A, 1mw2:A, 1mw3:A, 5n6v:A, 5n7j:A, 1s46:A, 1zs2:A
17	2cf4:A	330	28	0.1667	0.0303	0.3571	9.9	2wyr:A, 2wyr:B, 2wyr:C, 2wyr:D, 2wyr:E, 2wyr:F, 2wyr:G, 2wyr:H, 2wyr:I, 2wyr:J, 2wyr:K, 2wyr:L

[Back]