BioLiP

>protein
HHHHHAMWKCKKCGCDRFYQDITGGISEVLEMDKDGEVLDEIDDVEYGDFSCAKCDNSSSKIQEIAYWDEIN

The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7xmw:B	72	72	1.0000	1.0000	1.0000	3.26e-49	7xmw:A
2	6o1x:A	354	40	0.1944	0.0395	0.3500	0.038	6o1w:A, 6o1w:B, 6o1y:A
3	6fbz:A	191	44	0.1806	0.0681	0.2955	0.95
4	5yj8:A	60	57	0.2083	0.2500	0.2632	1.5	8jtn:A, 2lto:A, 6v9t:AAA, 6v9t:BBB
5	4oht:A	455	31	0.1250	0.0198	0.2903	2.4	4oht:B, 4ywu:A, 4ywu:B, 4ywv:A, 4ywv:B
6	5kj5:B	484	47	0.1528	0.0227	0.2340	3.6	4i1w:A, 4i1w:B, 4i1w:C, 4i1w:D, 4i25:A, 4i25:B, 4i25:C, 4i25:D, 4i2r:A, 4i2r:B, 4i2r:C, 4i2r:D, 5kj5:A, 5kj5:D, 5kj5:C, 5klk:A, 5klk:B, 5klk:D, 5klk:C, 5kll:A, 5kll:B, 5kll:C, 5kll:D, 5klm:A, 5klm:B, 5klm:C, 5klm:D, 5kln:A, 5kln:D, 5kln:B, 5kln:C, 5klo:A, 5klo:B, 5klo:C, 5klo:D, 4npi:A, 4npi:B, 4npi:C, 4npi:D, 4oe2:A, 4oe2:B, 4oe2:C, 4oe2:D, 4ou2:A, 4ou2:B, 4ou2:C, 4ou2:D, 4oub:A, 4oub:B, 4oub:C, 4oub:D
7	8q3b:A	1423	36	0.1528	0.0077	0.3056	4.4	8q3k:A
8	5x2n:C	433	72	0.2778	0.0462	0.2778	7.4	5x2m:A, 5x2m:C, 5x2n:A, 5x2o:A, 5x2o:C, 5x2p:A, 5x2p:C, 5x2q:A, 5x2q:C
9	7cnv:A	132	27	0.1250	0.0682	0.3333	9.6	7c8m:A, 7c8m:C, 7c8n:A, 7c8o:D, 7c8o:B, 7cnv:B, 7cnv:C, 7cnv:D, 7cnv:E, 7cnv:F

[Back]