BioLiP

>protein
HGVTGELRRRADGIWQRILAHPFVAELYAGTLPMEKFKYYLLQDYNYLVNFAKALSLAASRAPSVDLMKTALELAYGTVT
GEMANYEALLKEVGLSLRDAAEAEPNRVNVSYMAYLKSTCALEGFYQCMAALLPCFWSYAEIAERHGGKLRENPVHVYKK
WASVYLSPEYRGLVERLRAVLDSSGLSAEELWPYFKEASLYELEFWQAAYEGH

The query sequence (length=213) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2gm8:A	217	213	1.0000	0.9816	1.0000	9.95e-158	2gm8:B, 2gm8:C, 2gm8:D
2	2qcx:B	227	211	0.3286	0.3084	0.3318	4.63e-27	2qcx:A, 1to9:A, 1to9:B, 1yak:A, 1yak:B, 1yak:C, 1yak:D
3	1rtw:B	209	215	0.2911	0.2967	0.2884	2.57e-16	1rtw:A, 1rtw:C, 1rtw:D
4	1z72:B	215	211	0.2394	0.2372	0.2417	1.87e-10
5	2f2g:A	215	118	0.1221	0.1209	0.2203	0.003	2f2g:B, 2q4x:A, 2q4x:B
6	2b0q:A	263	51	0.0704	0.0570	0.2941	0.60	2bkk:A, 2bkk:C, 1j7l:A, 1j7l:B, 1j7u:A, 1j7u:B, 1l8t:A, 3q2j:A, 3q2j:B, 3tm0:A
7	2vaw:A	315	90	0.1080	0.0730	0.2556	0.73	1ofu:A, 1ofu:B
8	4hhz:D	296	50	0.0845	0.0608	0.3600	2.3
9	6mhu:G	341	75	0.0939	0.0587	0.2667	3.8
10	6c66:G	832	58	0.0798	0.0204	0.2931	6.9
11	2onr:A	314	75	0.0798	0.0541	0.2267	7.1	3cij:A, 3cij:B, 2onk:E, 2onk:J, 2ons:A
12	3ju8:A	486	29	0.0563	0.0247	0.4138	7.6	3ju8:B
13	2zy2:A	521	47	0.0704	0.0288	0.3191	7.8
14	6zho:A	577	83	0.1174	0.0433	0.3012	8.4	8ax5:A, 8ax6:A, 8ax7:A, 6d1u:A, 6d1u:B, 6d1u:C, 3n7r:A, 3n7r:C, 3n7r:D, 3n7r:B, 3n7s:A, 3n7s:C, 3n7s:D, 3n7s:B, 7p0f:A, 7p0i:A, 4rwg:A, 4rwg:B, 4rwg:C, 5v6y:A, 5v6y:B, 5v6y:C, 5v6y:D, 6zis:A

[Back]