HGSAFNTLVFSDEFEYEGKPDPEKWHYQVIPPNNGSWHNNELQHYTNRSENSFVSDGTLKIRAIKEKYTFEGSTKDYTSA
RLNSKFAFTYGKVEVRAKLPSKKGTWPAIWTLGANSNETGNYFGEQYGNAEWPACGSIDILEQNGWDKESTIAHFHWSDL
NSDEYQNLGGTTPITNASGSFHVYSLEWNASAMKVFLDDTLVYELKNSQNTPYNAPHYLLLNIAMGGTLGGDIPENFTDD
IFEIDYVRIYQ
The query sequence (length=251) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4bpz:B | 252 | 251 | 1.0000 | 0.9960 | 1.0000 | 0.0 | 4bow:A, 4bow:B, 4bpz:A, 4bq1:A, 4bq1:B |
2 | 3iln:A | 251 | 259 | 0.4223 | 0.4223 | 0.4093 | 4.11e-53 | 3iln:B |
3 | 3azx:A | 252 | 262 | 0.3705 | 0.3690 | 0.3550 | 4.33e-42 | 3azx:B, 3azy:A, 3azy:B, 3azy:C, 3azy:D, 3azz:A, 3azz:B, 3azz:C, 3azz:D, 3b00:A, 3b00:B, 3b00:C, 3b00:D, 3b01:A, 3b01:B, 3b01:C, 3b01:D, 4dfs:A, 4dfs:B |
4 | 6xof:A | 265 | 259 | 0.3745 | 0.3547 | 0.3629 | 2.64e-41 | 6xqf:A, 6xqg:A, 6xqh:A, 6xql:A, 6xqm:A |
5 | 7ww4:A | 480 | 254 | 0.3745 | 0.1958 | 0.3701 | 4.50e-40 | 7wwc:A |
6 | 4crq:A | 231 | 253 | 0.3665 | 0.3983 | 0.3636 | 4.75e-37 | 4crq:B, 4cte:A, 4cte:B |
7 | 6jh5:A | 232 | 252 | 0.3705 | 0.4009 | 0.3690 | 7.07e-35 | 6jhj:A, 6jia:A, 6m6p:A |
8 | 6t2n:AAA | 278 | 271 | 0.3665 | 0.3309 | 0.3395 | 7.71e-33 | 6t2n:BBB |
9 | 2hyk:A | 237 | 265 | 0.3307 | 0.3502 | 0.3132 | 3.73e-28 | |
10 | 2vy0:A | 264 | 263 | 0.3307 | 0.3144 | 0.3156 | 4.64e-27 | 2vy0:B |
11 | 8xph:A | 254 | 262 | 0.3068 | 0.3031 | 0.2939 | 1.17e-26 | 8xph:B, 8xpk:A, 8xpk:B |
12 | 3atg:A | 242 | 259 | 0.2908 | 0.3017 | 0.2819 | 1.58e-24 | |
13 | 5nbp:A | 237 | 235 | 0.2709 | 0.2869 | 0.2894 | 1.92e-20 | 7kr6:AAA, 7kr6:BBB, 5nbp:B, 6vho:AAA |
14 | 7eo3:A | 282 | 284 | 0.3068 | 0.2730 | 0.2711 | 1.85e-16 | |
15 | 3dgt:A | 278 | 248 | 0.2550 | 0.2302 | 0.2581 | 1.59e-09 | |
16 | 1ups:A | 402 | 266 | 0.2669 | 0.1667 | 0.2519 | 2.99e-09 | 1ups:B |
17 | 6t2o:BBB | 242 | 265 | 0.2629 | 0.2727 | 0.2491 | 1.75e-08 | 6t2o:AAA, 6t2p:AAA, 6t2p:BBB, 6t2q:AAA, 6t2q:BBB |
18 | 4w65:A | 231 | 264 | 0.2869 | 0.3117 | 0.2727 | 2.15e-08 | |
19 | 4wzf:B | 241 | 264 | 0.2669 | 0.2780 | 0.2538 | 1.03e-07 | 4wzf:A |
20 | 6t2s:AAA | 241 | 266 | 0.2590 | 0.2697 | 0.2444 | 1.07e-07 | 6t2s:BBB, 6t2s:CCC |
21 | 4xdq:A | 237 | 266 | 0.2749 | 0.2911 | 0.2594 | 7.94e-07 | |
22 | 9int:A | 282 | 284 | 0.2749 | 0.2447 | 0.2430 | 9.53e-07 | |
23 | 8ep4:A | 265 | 249 | 0.2470 | 0.2340 | 0.2490 | 1.23e-05 | 8ep4:B, 8ep4:C, 8ew1:A, 8ew1:B, 8ew1:C |
24 | 4pq9:A | 233 | 263 | 0.2590 | 0.2790 | 0.2471 | 1.35e-05 | 4pq9:B |
25 | 3rq0:A | 230 | 263 | 0.2789 | 0.3043 | 0.2662 | 5.92e-04 | |
26 | 3wdv:A | 298 | 77 | 0.1076 | 0.0906 | 0.3506 | 6.62e-04 | 3wdu:A, 3wdu:B, 3wdu:C, 3wdu:D, 3wdv:B, 3wdv:C, 3wdv:D, 3wdx:A, 3wdx:B, 3wdy:A, 3wdy:B, 3wdy:C, 3wdy:D |
27 | 3i4i:A | 215 | 190 | 0.1753 | 0.2047 | 0.2316 | 0.072 | 3i4i:B |
28 | 1mve:A | 243 | 151 | 0.1434 | 0.1481 | 0.2384 | 0.088 | 3axd:A, 3axd:B, 3axe:A, 3h0o:A, 3hr9:A, 2r49:A, 1zm1:A, 1zm1:B |
29 | 2cl2:A | 298 | 137 | 0.1434 | 0.1208 | 0.2628 | 0.11 | 2w39:A, 2w52:A, 2wlq:A, 2wne:A |
30 | 4xxp:A | 207 | 139 | 0.1554 | 0.1884 | 0.2806 | 0.47 | |
31 | 5ocq:B | 279 | 112 | 0.1355 | 0.1219 | 0.3036 | 0.70 | 5ocq:A |
32 | 8oin:Aa | 381 | 26 | 0.0438 | 0.0289 | 0.4231 | 0.74 | 8oip:Aa, 8oiq:Aa, 8oir:Aa, 8ois:Aa, 8oit:Aa |
33 | 6u7k:A | 1064 | 60 | 0.0757 | 0.0179 | 0.3167 | 0.80 | |
34 | 2ayh:A | 214 | 206 | 0.1952 | 0.2290 | 0.2379 | 1.1 | 1byh:A, 1glh:A, 1mac:A, 1mac:B, 1u0a:A, 1u0a:B, 1u0a:C, 1u0a:D |
35 | 1umz:A | 267 | 45 | 0.0518 | 0.0487 | 0.2889 | 1.7 | 1umz:B |
36 | 5m1i:A | 539 | 84 | 0.0956 | 0.0445 | 0.2857 | 2.3 | 6gta:A, 6gvd:A, 6gwf:A, 6gwg:A, 6gx8:A, 5m0x:A, 5m12:A, 5m16:A |
37 | 7fa1:A | 276 | 57 | 0.0677 | 0.0616 | 0.2982 | 2.5 | |
38 | 7bka:E | 171 | 49 | 0.0598 | 0.0877 | 0.3061 | 4.7 | 4b0b:A, 4b0b:B, 4b0c:A, 4b0c:B, 4b0c:D, 4b0c:C, 4b0c:E, 4b0i:A, 4b0i:B, 4b0i:C, 4b0i:D, 4b0i:E, 4b0j:A, 4b0j:B, 4b0j:C, 4b0j:D, 4b0j:E, 4b0j:F, 4b0j:G, 4b0j:H, 4b0j:I, 4b0j:J, 4b0j:K, 4b0j:L, 4b0j:M, 4b0j:N, 4b0j:O, 4b0j:P, 4b0j:Q, 4b0j:R, 4b0j:S, 4b0j:T, 8b72:A, 8b72:B, 4b8u:A, 4b8u:B, 7bhj:B, 7bhj:C, 7bhj:D, 7bhj:E, 7bis:A, 7bis:B, 7bis:C, 7bis:D, 7bis:E, 7bk9:A, 7bk9:B, 7bk9:C, 7bk9:D, 7bk9:E, 7bka:A, 7bka:B, 7bka:C, 7bka:D, 4cl6:A, 4cl6:B, 4cl6:C, 4cl6:D, 4cl6:E |
39 | 7wh0:A | 529 | 46 | 0.0478 | 0.0227 | 0.2609 | 5.6 | 7wh0:B |
40 | 1axk:B | 394 | 51 | 0.0558 | 0.0355 | 0.2745 | 9.2 | 1axk:A |