HGKPASGHKVRTQHSRRWWMQSKAHHLTAVPHEEARSRPHFPAYTEDVDQPMVVPDGVCCFNCDKPIDGDDINSYVWVPS
GNARVPTTQGYFFHVKCFKCWNCKYRIIHNQFYSKDSRAWCLSCALGRDIRVPTRRWHTSYVNTHRTGSRLTGQFFPRHR
HQMEFLF
The query sequence (length=167) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aih:Ax | 167 | 167 | 1.0000 | 1.0000 | 1.0000 | 5.10e-127 | 7am2:Ax, 7ane:Ax |
2 | 6yxy:BX | 133 | 130 | 0.6168 | 0.7744 | 0.7923 | 9.46e-78 | 7aoi:BX, 6hiv:BX, 6hix:BX |
3 | 1x61:A | 72 | 32 | 0.0778 | 0.1806 | 0.4062 | 0.002 | |
4 | 1x63:A | 82 | 36 | 0.0778 | 0.1585 | 0.3611 | 0.12 | |
5 | 2cup:A | 101 | 70 | 0.1078 | 0.1782 | 0.2571 | 0.13 | |
6 | 2d8z:A | 70 | 31 | 0.0659 | 0.1571 | 0.3548 | 0.28 | |
7 | 2dj7:A | 80 | 30 | 0.0778 | 0.1625 | 0.4333 | 0.41 | |
8 | 2mbv:A | 96 | 35 | 0.0659 | 0.1146 | 0.3143 | 0.47 | |
9 | 2cuq:A | 80 | 31 | 0.0599 | 0.1250 | 0.3226 | 0.50 | |
10 | 2dfy:X | 158 | 38 | 0.0719 | 0.0759 | 0.3158 | 0.97 | 2dfy:C, 1rut:X |
11 | 1g47:A | 70 | 38 | 0.0599 | 0.1429 | 0.2632 | 0.98 | 2kbx:B |
12 | 3f6q:B | 72 | 38 | 0.0599 | 0.1389 | 0.2632 | 1.1 | 4hi8:B, 4hi9:B |
13 | 2ehe:A | 82 | 32 | 0.0659 | 0.1341 | 0.3438 | 2.1 | |
14 | 2jae:A | 478 | 53 | 0.0958 | 0.0335 | 0.3019 | 2.5 | 2jae:B, 2jb1:A, 2jb1:B, 2jb2:A, 2jb2:B, 2jb3:A, 2jb3:B |
15 | 1x4k:A | 72 | 36 | 0.0719 | 0.1667 | 0.3333 | 2.8 | |
16 | 7de9:A | 58 | 49 | 0.0778 | 0.2241 | 0.2653 | 3.4 | |
17 | 3fzi:A | 258 | 29 | 0.0599 | 0.0388 | 0.3448 | 3.4 | 3g00:A, 3g00:B, 3g0a:A, 3g0r:A, 3g0r:B, 3g1k:A, 3g1k:B, 3g2c:A, 3g2c:B, 3g2d:A, 3g2d:B, 3g38:A, 3g3c:A, 3g3c:B, 3g3y:B, 3g3y:A, 3g4t:A, 3g4t:B, 3ga6:A, 3ga6:B, 3w2x:A, 3w2y:A, 3w2y:D |
18 | 8y6k:A | 741 | 15 | 0.0479 | 0.0108 | 0.5333 | 4.2 | 2bra:A, 2bra:B, 2bry:A, 2bry:B, 2c4c:A, 2c4c:B, 4txi:A, 4txk:A |
19 | 2d8y:A | 91 | 29 | 0.0539 | 0.0989 | 0.3103 | 5.1 | |
20 | 2jtn:A | 182 | 39 | 0.0838 | 0.0769 | 0.3590 | 5.2 | |
21 | 3ixe:B | 70 | 38 | 0.0659 | 0.1571 | 0.2895 | 5.3 | |
22 | 4v4n:Ae | 62 | 44 | 0.0659 | 0.1774 | 0.2500 | 5.9 | 4v6u:Be |
23 | 2rgt:B | 154 | 39 | 0.0838 | 0.0909 | 0.3590 | 7.2 | 2rgt:A |
24 | 7lt9:B | 131 | 68 | 0.1018 | 0.1298 | 0.2500 | 8.1 | 7d2s:B, 7d2t:B, 7d2t:D, 7d2u:B, 1nyp:A, 1u5s:B |
25 | 6mif:A | 79 | 68 | 0.1018 | 0.2152 | 0.2500 | 8.1 | |
26 | 1x3h:A | 80 | 59 | 0.0838 | 0.1750 | 0.2373 | 9.6 |