Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
HGEGTFTSDVSSYLEGQAAKEFIAWLVRGR

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 4apd:A 31 30 0.9667 0.9355 0.9667 7.32e-16 7ki0:P
2 6gdz:A 39 29 0.5667 0.4359 0.5862 1.78e-05 6ge2:A
3 5niq:A 39 29 0.4667 0.3590 0.4828 3.67e-05
4 2qkh:B 32 30 0.3333 0.3125 0.3333 0.10
5 6rxu:CR 760 14 0.2667 0.0105 0.5714 5.3 6rxv:CR, 6rxx:CR, 6rxz:CR
6 7x07:A 633 24 0.3667 0.0174 0.4583 6.6 7shn:A, 7shn:B, 7vzb:A, 7vzb:B, 7x0t:A, 7x0t:B, 7x1w:A, 7x1w:B, 7xec:A, 7yrq:A, 7yrq:B
7 7x0z:B 580 24 0.3667 0.0190 0.4583 6.9 7shm:A, 7shm:B, 7x0z:A
8 7rr9:A 560 24 0.3667 0.0196 0.4583 7.0 7rr9:B, 7vx8:B, 7vx8:A
9 6fie:B 255 25 0.3333 0.0392 0.4000 7.4
10 1fi6:A 92 18 0.2667 0.0870 0.4444 7.6

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218