HGASRYKKSRAKMRWKWKKKRTRRLQKKRRKMRQRSR
The query sequence (length=37) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 6tmf:c | 37 | 21 | 0.4324 | 0.4324 | 0.7619 | 0.023 | 6skf:Bk, 6skg:Bk, 6sw9:0, 6swc:0, 6swd:0, 6th6:Bk, 7zag:0, 7zah:0, 7zai:0, 7zhg:0 |
| 2 | 6lke:A | 428 | 21 | 0.2162 | 0.0187 | 0.3810 | 3.9 | 6lkd:A, 6lkd:B, 6lke:B |
zhanggroup.org