HFFEGTEKLLEVWFSGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
The query sequence (length=55) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 1jl0:B | 311 | 57 | 1.0000 | 0.1768 | 0.9649 | 7.51e-32 | 3dz2:B, 3dz2:A, 3dz3:B, 3dz3:A, 3dz4:B, 3dz4:A, 3dz5:B, 3dz5:A, 3dz6:B, 3dz6:A, 3dz7:B, 3dz7:A, 3ep3:A, 3ep4:A, 3ep5:A, 3ep6:B, 3ep6:A, 3ep7:B, 3ep7:A, 3ep8:B, 3ep8:A, 3ep9:A, 3epa:A, 3epb:A, 3h0v:B, 3h0v:A, 3h0w:B, 3h0w:A, 1i72:B, 1i72:A, 1i79:B, 1i79:A, 1i7b:B, 1i7b:A, 1i7c:A, 1i7c:B, 1i7m:A, 1i7m:B, 1i7m:C, 1i7m:D, 1jl0:A |
| 2 | 7tui:B | 2033 | 40 | 0.2545 | 0.0069 | 0.3500 | 1.4 | 6u5v:B, 6u5w:B |
| 3 | 3fsr:A | 352 | 15 | 0.1636 | 0.0256 | 0.6000 | 2.5 | 3fsr:C, 3ftn:A, 3ftn:B, 3ftn:C, 3ftn:D |
| 4 | 6sch:C | 355 | 15 | 0.1636 | 0.0254 | 0.6000 | 2.5 | 2b83:A, 2b83:B, 2b83:C, 2b83:D, 1jqb:A, 1jqb:B, 1jqb:C, 1jqb:D, 1kev:A, 1kev:B, 1kev:C, 1kev:D, 1ped:A, 1ped:B, 1ped:C, 1ped:D, 6sch:A, 6sch:B, 6sch:D |
| 5 | 3fpc:A | 352 | 19 | 0.1818 | 0.0284 | 0.5263 | 4.0 | 3fpc:B, 3fpc:C, 3fpc:D |
| 6 | 2oui:A | 360 | 19 | 0.1818 | 0.0278 | 0.5263 | 4.1 | 2oui:B, 2oui:C, 2oui:D, 1y9a:A, 1y9a:C |
| 7 | 7bc4:B | 2054 | 51 | 0.2909 | 0.0078 | 0.3137 | 4.9 | |
| 8 | 7poa:A | 398 | 20 | 0.1818 | 0.0251 | 0.5000 | 5.7 | 7poa:B, 7pob:A, 7pob:D, 7pob:B, 7pob:C, 7poc:A, 7poc:D, 7poc:B, 7poc:C |
| 9 | 4gao:A | 193 | 32 | 0.2182 | 0.0622 | 0.3750 | 6.1 | 4gao:B, 4gao:D, 4gao:G |
| 10 | 6d4b:A | 361 | 20 | 0.1636 | 0.0249 | 0.4500 | 7.1 | 6d4b:B, 6d4c:A, 6d4c:B, 5dn9:A, 5dn9:B |
| 11 | 8phn:A | 124 | 39 | 0.1636 | 0.0726 | 0.2308 | 9.6 |
umich.edu