BioLiP

>protein
HAGTMTLEAYMRFSAKLSEAKDEMGTKEYEVFTKELKKLTNAKLAYGDANGNIDYDALSPEKREEMKTVSMGLQPYFDKL
NGHKSSKEVLTQEEFDRYMEALMTHEIVRVKTKSTGAIKVEEVPEAYKERFMKAEQFMEYVDEKVR

The query sequence (length=146) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3fgg:A	147	146	1.0000	0.9932	1.0000	1.45e-105	3fgg:B
2	4wai:A	91	49	0.1027	0.1648	0.3061	0.59	4wai:C, 4wai:B, 4wai:D
3	5o7h:B	129	77	0.1575	0.1783	0.2987	0.92
4	5o6u:B	182	73	0.1575	0.1264	0.3151	1.0
5	3zni:A	390	138	0.2192	0.0821	0.2319	1.5	4a49:A, 5axi:B, 5axi:A, 5axi:C, 9fqh:A, 9fqi:A, 9fqj:A, 9fqj:B, 8gcy:A, 2ldr:A, 3pfv:A, 3pfv:B, 8qng:A, 8qnh:A, 8qni:A, 8qtg:A, 8qth:A, 8qtj:A, 8qtk:A, 8vw4:A, 8vw4:B, 8vw5:A, 8vw5:B, 3zni:E, 3zni:I, 3zni:M
6	6knb:B	1120	62	0.1164	0.0152	0.2742	1.6	6knc:B
7	5tw7:F	490	48	0.1438	0.0429	0.4375	2.6	5tw7:E
8	4kif:B	339	71	0.1644	0.0708	0.3380	2.8	4kib:A, 4kib:B, 4kic:A, 4kic:B, 4kif:A, 4kig:A, 4kig:B, 4m6x:A, 4m6x:B, 4m6y:A, 4m6y:B, 4m71:A, 4m71:B, 4m72:A, 4m72:B, 4m73:A, 4m73:B, 4m74:A, 4m74:B
9	3j6b:C	249	29	0.0822	0.0482	0.4138	3.6	5mrc:C, 5mre:C, 5mrf:C
10	6adq:E	312	26	0.0753	0.0353	0.4231	4.2	6adq:Q, 8ovc:X, 8ovd:Q, 8ovd:X, 7rh5:Q, 7rh5:K, 7rh6:Q, 7rh6:K, 7rh7:Q, 7rh7:K
11	8ovc:Q	286	47	0.1027	0.0524	0.3191	7.2	7e1v:E, 7e1v:Q, 7e1w:E, 7e1w:Q, 7e1x:E, 7e1x:Q, 6hwh:P, 6hwh:L
12	8vxa:A	1139	51	0.1027	0.0132	0.2941	8.5	8vxc:A
13	8vxy:B	1161	51	0.1027	0.0129	0.2941	8.5
14	6ly5:H	170	40	0.0959	0.0824	0.3500	9.3
15	8xw0:B	696	57	0.1096	0.0230	0.2807	9.3	8xw0:A

[Back]