GYKIRNKSIFWTRAGWKNNWHPKNFNAPRPSYGEFTMGIRCRNDHHSFLRYVQTYRNMSRHCKQYFLGDKQLEETFILGL
RSLFLVPYDSQCLTDQIKHGGERRFVDQLDRDFELISYNTHPYQLFTYTVRNEHLAWKNEQYEKIQKGEKTFEQELLDYL
DEQVLAEKAKLRDGQNFSIERMTEIALHVFRKARAGKVRPAQDVRGPDGNVNDFLEQRRPFEHPNPTGVTH
The query sequence (length=231) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6ynx:h | 231 | 231 | 1.0000 | 1.0000 | 1.0000 | 4.63e-178 | 6ynx:H, 6yny:h, 6yny:H, 6ynz:h, 6ynz:H, 6ynz:h3, 6ynz:H3 |
2 | 5m0t:A | 287 | 65 | 0.0736 | 0.0592 | 0.2615 | 0.25 | 5m0t:B |
3 | 3ebl:A | 323 | 55 | 0.0649 | 0.0464 | 0.2727 | 1.8 | 3ebl:B, 3ebl:C, 3ebl:D, 3ebl:E, 3ebl:F, 3ed1:A, 3ed1:B, 3ed1:C, 3ed1:D, 3ed1:E, 3ed1:F |
4 | 8eeg:B | 440 | 121 | 0.1212 | 0.0636 | 0.2314 | 2.3 | 8eef:A, 8eef:B, 8eeg:A, 8eeh:A, 8eeh:B, 8eei:A, 8eei:B, 8eej:B, 8eej:A, 8eek:A, 8eek:B, 8eel:A, 8eel:B, 8eem:A, 8eem:B, 8een:B, 8een:A, 8eeo:A, 8eeo:B |
5 | 2zsi:A | 339 | 76 | 0.0909 | 0.0619 | 0.2763 | 5.3 | 2zsh:A |
6 | 4wwh:A | 329 | 36 | 0.0390 | 0.0274 | 0.2500 | 5.9 | 4wwh:B |
7 | 6z1p:AL | 145 | 91 | 0.1212 | 0.1931 | 0.3077 | 5.9 | |
8 | 7pkt:k | 210 | 83 | 0.1039 | 0.1143 | 0.2892 | 6.4 |