BioLiP

>protein
GWEIPEPYVWDESFRVFYEQLDEEHKKIFKGIFDCIRDNSAPNLATLVKVTTNHFTHEEAMMDAAKYSEVVPHKKMHKDF
LEKIGGLSAPVDAKNVDYCKEWLVNHIKGTDFKYKGKL

The query sequence (length=118) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1a7d:A	118	118	1.0000	1.0000	1.0000	1.16e-86	1a7e:A, 2mhr:A
2	1i4y:A	113	118	0.4576	0.4779	0.4576	2.04e-32	1i4y:B, 1i4y:C, 1i4y:D, 1i4y:E, 1i4y:F, 1i4y:G, 1i4y:H, 1i4z:A, 1i4z:B, 1i4z:C, 1i4z:D, 1i4z:E, 1i4z:F, 1i4z:G, 1i4z:H
3	1hmd:A	113	118	0.4322	0.4513	0.4322	3.09e-31	1hmd:B, 1hmd:C, 1hmd:D, 1hmo:A, 1hmo:B, 1hmo:C, 1hmo:D, 2hmq:A, 2hmq:B, 2hmq:C, 2hmq:D, 2hmz:A, 2hmz:B, 2hmz:C, 2hmz:D
4	3waq:A	134	112	0.2458	0.2164	0.2589	1.24e-04	3agt:A, 3agt:B, 3agu:A, 3agu:B, 2avk:A, 2awc:A, 2awy:A, 2awy:B, 3whn:A, 3whn:B
5	4xpw:A	131	108	0.2458	0.2214	0.2685	1.80e-04	4xpx:A, 4xpy:A, 4xq1:A
6	6br8:A	249	60	0.1271	0.0602	0.2500	1.2	6br8:B, 6br9:A
7	8gvw:A	671	69	0.1441	0.0253	0.2464	4.4	6aei:A, 6aei:D, 6aei:B, 6aei:C, 7d4p:A, 7d4p:D, 7d4p:B, 7d4p:C, 7d4q:A, 7d4q:D, 7d4q:B, 7d4q:C, 7e4t:A, 7e4t:D, 7e4t:B, 7e4t:C, 8gvw:D, 8gvw:B, 8gvw:C, 7wdb:A, 7wdb:D, 7wdb:B, 7wdb:C
8	7x6i:A	687	69	0.1441	0.0247	0.2464	4.6	8gvx:B, 8gvx:A, 8gvx:D, 8gvx:C, 7x6c:C, 7x6c:B, 7x6c:A, 7x6c:D, 7x6i:D, 7x6i:B, 7x6i:C, 6ysn:A, 6ysn:B, 6ysn:C, 6ysn:D
9	8tlq:A	1283	28	0.0932	0.0086	0.3929	5.5	8tlt:A, 6v93:A
10	7s0t:A	1231	20	0.0847	0.0081	0.5000	7.1
11	5y4c:A	249	51	0.1441	0.0683	0.3333	7.2
12	1gpm:A	501	71	0.1949	0.0459	0.3239	7.6	1gpm:B, 1gpm:C, 1gpm:D
13	7sup:A	129	59	0.1525	0.1395	0.3051	9.5	7svc:A, 7swg:A, 7swi:A, 7sxc:A

[Back]