GTREKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR
The query sequence (length=79) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6wjp:A | 80 | 79 | 0.9873 | 0.9750 | 0.9873 | 1.03e-51 | 5jvo:A, 5jvo:B, 6wjo:A, 6wjo:B, 6wjp:B |
2 | 3fhz:D | 166 | 79 | 0.5443 | 0.2590 | 0.5443 | 4.87e-25 | 3cag:A, 3cag:C, 3cag:E, 3cag:B, 3cag:D, 3cag:F, 3ere:D, 3fhz:C, 3fhz:E, 3fhz:B, 3fhz:F, 3fhz:A, 3laj:C, 3laj:E, 3laj:B, 3laj:F, 3laj:A, 3laj:D, 3lap:C, 3lap:E, 3lap:B, 3lap:F, 3lap:A, 3lap:D, 2zfz:A, 2zfz:C, 2zfz:F, 2zfz:B, 2zfz:D, 2zfz:E |
3 | 1b4b:A | 71 | 64 | 0.3038 | 0.3380 | 0.3750 | 1.68e-12 | 1b4b:C, 1b4b:B |
4 | 2p5m:A | 82 | 61 | 0.2911 | 0.2805 | 0.3770 | 3.10e-12 | 2p5m:B, 2p5m:C |
5 | 1xxa:C | 73 | 65 | 0.3038 | 0.3288 | 0.3692 | 1.98e-09 | 1xxa:A, 1xxa:B, 1xxa:D, 1xxa:F, 1xxa:E, 1xxb:A, 1xxb:C, 1xxb:B, 1xxb:D, 1xxb:E, 1xxb:F |
6 | 5eer:A | 247 | 60 | 0.2405 | 0.0769 | 0.3167 | 1.00 | 5ees:A |
7 | 2ecg:A | 75 | 54 | 0.1899 | 0.2000 | 0.2778 | 1.2 | 4ic2:A, 4ic2:B, 4ic3:A, 4ic3:B, 5o6t:A, 5o6t:B, 8w59:A, 8w59:B, 8w5a:A, 8w5a:B |
8 | 7mqa:NA | 295 | 51 | 0.1772 | 0.0475 | 0.2745 | 1.9 | 7mq8:NA, 7mq9:NA |
9 | 3lot:D | 313 | 40 | 0.1772 | 0.0447 | 0.3500 | 2.4 | 3lot:A, 3lot:B, 3lot:C |
10 | 6yw5:SS | 81 | 58 | 0.2405 | 0.2346 | 0.3276 | 2.8 | 6ywe:SS, 6ywx:SS, 6ywy:SS |
11 | 8bpo:t2 | 418 | 27 | 0.1392 | 0.0263 | 0.4074 | 2.8 | |
12 | 6gsj:AA | 65 | 28 | 0.1519 | 0.1846 | 0.4286 | 3.0 | 5e7k:AA, 5e81:AA, 5el4:AA, 5el6:AA, 5el7:AA, 6gsk:AA, 6gsl:AA, 5ib7:AA, 5ib8:AA, 5ibb:AA |
13 | 6c4m:C | 418 | 21 | 0.1392 | 0.0263 | 0.5238 | 3.7 | |
14 | 4to8:A | 279 | 33 | 0.1772 | 0.0502 | 0.4242 | 5.1 | 4to8:B |
15 | 6joo:A | 834 | 35 | 0.1646 | 0.0156 | 0.3714 | 6.8 | |
16 | 8hmc:B | 1195 | 23 | 0.1139 | 0.0075 | 0.3913 | 7.5 | 8hmd:B |
17 | 7unr:s | 83 | 25 | 0.1392 | 0.1325 | 0.4400 | 8.2 | 8cd1:s, 6spc:s, 6spe:s, 6spf:s, 6spg:s, 7unu:s, 7unv:s, 7unw:s |
18 | 3a22:A | 614 | 40 | 0.1772 | 0.0228 | 0.3500 | 8.8 | 3a22:B, 3a23:A, 3a23:B |
19 | 3uoz:A | 540 | 48 | 0.1772 | 0.0259 | 0.2917 | 9.3 | 3uov:A, 3uov:B, 3uox:A, 3uox:B, 3uoy:A, 3uoy:B, 3uoz:B, 3up4:A, 3up4:B, 3up5:A, 3up5:B |