BioLiP

>protein
GTKQEKTILNMARFIRSQALTILEKANELDADEIADIAESIHDHADEIYRSALARFGDD

The query sequence (length=59) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1f4n:A	59	59	1.0000	1.0000	1.0000	1.60e-37	1f4m:A, 1f4m:C, 1f4m:E, 1f4n:B
2	1yo7:A	120	55	0.7627	0.3750	0.8182	3.03e-27	1yo7:B
3	1yo7:A	120	29	0.4068	0.2000	0.8276	1.25e-10	1yo7:B
4	5x51:M	1386	56	0.3390	0.0144	0.3571	1.1	5x4z:A, 5x51:A, 8yfr:A
5	5xon:A	1427	42	0.2712	0.0112	0.3810	1.9	6a5l:A, 6a5o:A, 6a5p:A, 6a5r:A, 6a5t:A, 6a5u:A, 8h0v:A, 8h0w:A, 8he5:A, 6inq:A, 6ir9:A, 6j4w:A, 6j4x:A, 6j4y:A, 6j4z:A, 6j50:A, 6j51:A, 8jh2:A, 8jh3:A, 8jh4:A, 7wbv:A, 7wbw:A, 7wbx:A, 5x4z:M, 5x50:A, 7xn7:A, 5xog:A, 7xse:A, 7xsx:A, 7xsz:A, 7xt7:A, 7xtd:A, 7xti:A, 8yfq:A
6	7d80:5	432	45	0.2712	0.0370	0.3556	3.2	7d6z:h, 1w2b:5
7	8yon:C	605	40	0.2373	0.0231	0.3500	3.9	9imj:A, 8ylu:C, 8ylu:D, 8yo1:C, 8yo1:D, 8yo7:D, 8yo7:C, 8yod:C, 8yod:D, 8yon:D
8	3wst:I	644	36	0.2542	0.0233	0.4167	5.4	3wst:A, 3wst:D, 3wst:B, 3wst:C, 3wst:F, 3wst:E, 3wst:G, 3wst:H, 3wst:M, 3wst:N, 3wst:O, 3wst:P, 3wst:Q, 3wst:R, 3wst:J, 3wst:K, 3wst:L, 3x0d:A
9	4kp4:A	219	33	0.2203	0.0594	0.3939	5.9	1bxd:A
10	8b9d:2	576	42	0.2542	0.0260	0.3571	7.3

[Back]