BioLiP

>protein
GSSGSSGVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPSGPSSG

The query sequence (length=80) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5y95:A	80	80	1.0000	1.0000	1.0000	9.83e-55
2	2czy:A	77	69	0.8500	0.8831	0.9855	3.95e-46
3	6xdj:A	441	67	0.2875	0.0522	0.3433	1.11e-09	6xaw:A, 6xdj:B
4	1e91:A	85	82	0.3125	0.2941	0.3049	3.84e-09	1pd7:A
5	1g1e:B	89	82	0.3000	0.2697	0.2927	8.82e-07	1s5q:B, 1s5r:B
6	6s1y:A	595	69	0.2750	0.0370	0.3188	0.084	6s1z:A
7	6wan:F	415	44	0.2000	0.0386	0.3636	0.23
8	6vm6:B	440	44	0.2000	0.0364	0.3636	0.24	6vm6:A, 6vm6:C, 6vm6:D, 6vm6:E, 6wan:A, 6wan:B, 6wan:C, 6wan:D, 6wan:E
9	7sss:F	173	45	0.1375	0.0636	0.2444	0.25	7sss:E, 7sss:H, 7sss:G
10	7qdy:A	1169	16	0.1250	0.0086	0.6250	0.63	7qdz:A, 7qe0:A
11	2izo:C	244	54	0.2125	0.0697	0.3148	0.65
12	7c2h:G	197	42	0.1500	0.0609	0.2857	3.5
13	3kfu:C	377	38	0.1625	0.0345	0.3421	4.3	3kfu:A, 3kfu:D, 3kfu:B
14	2wpb:A	302	35	0.1500	0.0397	0.3429	4.8	4bwl:A, 4bwl:B, 4bwl:C, 4bwl:D, 1fdy:A, 1fdy:B, 1fdy:C, 1fdy:D, 1fdz:A, 1fdz:B, 1fdz:C, 1fdz:D, 1hl2:A, 1hl2:B, 1hl2:C, 1hl2:D, 3lbc:D, 3lcw:A, 3lcw:B, 3lcw:C, 3lcw:D, 4uui:A, 4uui:B, 4uui:C, 4uui:D, 2wkj:C, 2wkj:D, 2wpb:B, 2wpb:C, 2wpb:D, 2xfw:A, 2xfw:B, 2xfw:C, 2xfw:D
15	7sh1:A	626	48	0.2500	0.0319	0.4167	5.7	7sh1:B
16	3oes:A	157	26	0.1250	0.0637	0.3846	7.7
17	1l9m:B	681	18	0.1000	0.0117	0.4444	7.8	1l9m:A, 1l9n:A, 1l9n:B, 1nud:A, 1nud:B, 1nuf:A, 1nug:A, 1nug:B, 8oxv:A, 8oxw:A, 8oxx:A
18	6hrk:A	135	12	0.1000	0.0593	0.6667	9.2	6hrk:B, 6hrk:C, 6hrk:D
19	1fu5:A	111	21	0.0875	0.0631	0.3333	9.8	1oo4:A

[Back]